Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 161719..161958 | Replicon | plasmid pIPCEC42_1 |
| Accession | NZ_AP026789 | ||
| Organism | Escherichia coli strain IPCEC42 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | A0A762TWR7 |
| Locus tag | OPA56_RS26380 | Protein ID | WP_023144756.1 |
| Coordinates | 161824..161958 (+) | Length | 45 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 161719..161779 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OPA56_RS26360 (159249) | 159249..159995 | + | 747 | WP_000205718.1 | conjugal transfer pilus acetylase TraX | - |
| OPA56_RS26365 (160050) | 160050..160610 | + | 561 | WP_000139341.1 | fertility inhibition protein FinO | - |
| OPA56_RS26370 (160741) | 160741..160953 | + | 213 | WP_013023861.1 | hypothetical protein | - |
| OPA56_RS26375 (161466) | 161466..161752 | + | 287 | Protein_185 | DUF2726 domain-containing protein | - |
| - (161719) | 161719..161779 | - | 61 | NuclAT_2 | - | Antitoxin |
| - (161719) | 161719..161779 | - | 61 | NuclAT_2 | - | Antitoxin |
| - (161719) | 161719..161779 | - | 61 | NuclAT_2 | - | Antitoxin |
| - (161719) | 161719..161779 | - | 61 | NuclAT_2 | - | Antitoxin |
| OPA56_RS26380 (161824) | 161824..161958 | + | 135 | WP_023144756.1 | Hok/Gef family protein | Toxin |
| OPA56_RS26385 (162387) | 162387..163133 | - | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| OPA56_RS26390 (163148) | 163148..164689 | - | 1542 | WP_001298859.1 | IS21-like element ISEc12 family transposase | - |
| OPA56_RS26395 (164880) | 164880..165095 | + | 216 | Protein_189 | replication regulatory protein RepA | - |
| OPA56_RS26400 (165201) | 165201..165332 | + | 132 | Protein_190 | protein CopA/IncA | - |
| OPA56_RS26405 (165332) | 165332..165406 | + | 75 | WP_031943482.1 | RepA leader peptide Tap | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5 / blaCTX-M-15 / blaOXA-1 / aac(6')-Ib-cr | senB | 1..165449 | 165449 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4896.90 Da Isoelectric Point: 7.7209
>T42718 WP_023144756.1 NZ_AP026789:161824-161958 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
Download Length: 135 bp
>T42718 NZ_AP026789:161824-161958 [Escherichia coli]
ATGACGAAATATACCCTTATCGGGTTGCTTGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACAGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTGA
ATGACGAAATATACCCTTATCGGGTTGCTTGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACAGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTGA
Antitoxin
Download Length: 61 bp
>AT42718 NZ_AP026789:c161779-161719 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|