Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 25386..25640 | Replicon | plasmid pIPCEC31_1 |
| Accession | NZ_AP026784 | ||
| Organism | Escherichia coli strain IPCEC31 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | OO978_RS23555 | Protein ID | WP_001312851.1 |
| Coordinates | 25491..25640 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 25386..25447 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OO978_RS23520 (21038) | 21038..21250 | + | 213 | WP_005012601.1 | hypothetical protein | - |
| OO978_RS23525 (21551) | 21551..21640 | - | 90 | Protein_27 | IS1 family transposase | - |
| OO978_RS23530 (21695) | 21695..22372 | + | 678 | WP_001339397.1 | IS66-like element accessory protein TnpA | - |
| OO978_RS23535 (22372) | 22372..22719 | + | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| OO978_RS23540 (22739) | 22739..24310 | + | 1572 | WP_023149734.1 | IS66-like element ISCro1 family transposase | - |
| OO978_RS23545 (24348) | 24348..24964 | - | 617 | Protein_31 | IS1-like element IS1A family transposase | - |
| OO978_RS23550 (25065) | 25065..25247 | + | 183 | WP_000968309.1 | hypothetical protein | - |
| - (25386) | 25386..25447 | - | 62 | NuclAT_0 | - | Antitoxin |
| - (25386) | 25386..25447 | - | 62 | NuclAT_0 | - | Antitoxin |
| - (25386) | 25386..25447 | - | 62 | NuclAT_0 | - | Antitoxin |
| - (25386) | 25386..25447 | - | 62 | NuclAT_0 | - | Antitoxin |
| OO978_RS23555 (25491) | 25491..25640 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| OO978_RS23560 (25924) | 25924..26181 | + | 258 | WP_000083833.1 | replication regulatory protein RepA | - |
| OO978_RS23565 (26417) | 26417..26491 | + | 75 | WP_032336874.1 | RepA leader peptide Tap | - |
| OO978_RS23570 (26484) | 26484..26930 | + | 447 | Protein_36 | plasmid replication initiator RepA | - |
| OO978_RS23575 (26930) | 26930..27544 | - | 615 | Protein_37 | VENN motif pre-toxin domain-containing protein | - |
| OO978_RS23580 (28251) | 28251..29471 | + | 1221 | WP_000410951.1 | arginine deiminase | - |
| OO978_RS23585 (29482) | 29482..30393 | + | 912 | WP_000440183.1 | carbamate kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | tet(A) / aac(6')-Ib-cr / blaOXA-1 / blaCTX-M-15 / aadA5 / qacE / sul1 / mph(A) / sitABCD | iucA / iucB / iucC / iucD / iutA | 1..102618 | 102618 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T42679 WP_001312851.1 NZ_AP026784:25491-25640 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T42679 NZ_AP026784:25491-25640 [Escherichia coli]
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 62 bp
>AT42679 NZ_AP026784:c25447-25386 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
