Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/Fst(toxin) |
Location | 17350..17593 | Replicon | plasmid pSVR2330_1 |
Accession | NZ_AP026722 | ||
Organism | Enterococcus faecalis strain SVR2330 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | PO855_RS16035 | Protein ID | WP_002387930.1 |
Coordinates | 17492..17593 (-) | Length | 34 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 17350..17452 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PO855_RS16020 (13061) | 13061..16047 | + | 2987 | Protein_13 | Tn3 family transposase | - |
PO855_RS16025 (16231) | 16231..16521 | - | 291 | WP_002365947.1 | hypothetical protein | - |
PO855_RS16030 (16692) | 16692..17153 | - | 462 | WP_002365946.1 | hypothetical protein | - |
- (17350) | 17350..17452 | + | 103 | NuclAT_0 | - | Antitoxin |
- (17350) | 17350..17452 | + | 103 | NuclAT_0 | - | Antitoxin |
- (17350) | 17350..17452 | + | 103 | NuclAT_0 | - | Antitoxin |
- (17350) | 17350..17452 | + | 103 | NuclAT_0 | - | Antitoxin |
PO855_RS16035 (17492) | 17492..17593 | - | 102 | WP_002387930.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
PO855_RS16040 (17684) | 17684..17896 | - | 213 | WP_002365945.1 | hypothetical protein | - |
PO855_RS16045 (17853) | 17853..18203 | - | 351 | WP_002365943.1 | hypothetical protein | - |
PO855_RS16050 (18200) | 18200..19528 | - | 1329 | WP_002387639.1 | ultraviolet resistance protein UvrA | - |
PO855_RS16055 (19955) | 19955..20107 | - | 153 | WP_225850000.1 | DUF6440 family protein | - |
PO855_RS16060 (20269) | 20269..20478 | - | 210 | WP_002387638.1 | hypothetical protein | - |
PO855_RS16065 (20539) | 20539..20763 | - | 225 | WP_010708492.1 | ultraviolet resistance protein UvrA repressor UvrC | - |
PO855_RS16070 (20757) | 20757..21044 | - | 288 | WP_010708491.1 | hypothetical protein | - |
PO855_RS16075 (21061) | 21061..21681 | - | 621 | WP_021732893.1 | recombinase family protein | - |
PO855_RS16080 (22211) | 22211..22417 | - | 207 | Protein_25 | transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | - | prgB/asc10 | 1..73523 | 73523 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 34 a.a. Molecular weight: 3731.42 Da Isoelectric Point: 4.1672
>T42625 WP_002387930.1 NZ_AP026722:c17593-17492 [Enterococcus faecalis]
VKDLMSLVIAPIFVGLVLEMISRVLDEEDDSRK
VKDLMSLVIAPIFVGLVLEMISRVLDEEDDSRK
Download Length: 102 bp
>T42625 NZ_AP026722:c17593-17492 [Enterococcus faecalis]
GTGAAAGATTTAATGTCGTTGGTTATCGCACCAATCTTTGTAGGATTGGTTCTGGAAATGATTTCTCGTGTGTTGGACGA
GGAAGACGATAGCCGAAAGTAA
GTGAAAGATTTAATGTCGTTGGTTATCGCACCAATCTTTGTAGGATTGGTTCTGGAAATGATTTCTCGTGTGTTGGACGA
GGAAGACGATAGCCGAAAGTAA
Antitoxin
Download Length: 103 bp
>AT42625 NZ_AP026722:17350-17452 [Enterococcus faecalis]
TTGACCCAAAATAAAAATATGCTATACTAAAAGTGCGAAACGACATTAAATCGTACAGATAACACAAAAAGCAATCCTAC
GGCGAATAGGATTGCTTTTTTTT
TTGACCCAAAATAAAAATATGCTATACTAAAAGTGCGAAACGACATTAAATCGTACAGATAACACAAAAAGCAATCCTAC
GGCGAATAGGATTGCTTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|