Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-ohsC/Ldr(toxin)
Location 4378332..4378553 Replicon chromosome
Accession NZ_AP026118
Organism Escherichia coli strain CEC13004

Toxin (Protein)


Gene name ldrD Uniprot ID S1NWX0
Locus tag OO879_RS21995 Protein ID WP_001295224.1
Coordinates 4378332..4378439 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name ohsC
Locus tag -
Coordinates 4378488..4378553 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OO879_RS21970 (4373586) 4373586..4374338 - 753 Protein_4305 cellulose biosynthesis protein BcsQ -
OO879_RS21975 (4374350) 4374350..4374538 - 189 WP_001063316.1 cellulose biosynthesis protein BcsR -
OO879_RS21980 (4374810) 4374810..4376381 + 1572 WP_001204920.1 cellulose biosynthesis c-di-GMP-binding protein BcsE -
OO879_RS21985 (4376378) 4376378..4376569 + 192 WP_000988308.1 cellulose biosynthesis protein BcsF -
OO879_RS21990 (4376566) 4376566..4378245 + 1680 WP_000191596.1 cellulose biosynthesis protein BcsG -
OO879_RS21995 (4378332) 4378332..4378439 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (4378488) 4378488..4378553 + 66 NuclAT_16 - Antitoxin
- (4378488) 4378488..4378553 + 66 NuclAT_16 - Antitoxin
- (4378488) 4378488..4378553 + 66 NuclAT_16 - Antitoxin
- (4378488) 4378488..4378553 + 66 NuclAT_16 - Antitoxin
- (4378488) 4378488..4378553 + 66 NuclAT_21 - Antitoxin
- (4378488) 4378488..4378553 + 66 NuclAT_21 - Antitoxin
- (4378488) 4378488..4378553 + 66 NuclAT_21 - Antitoxin
- (4378488) 4378488..4378553 + 66 NuclAT_21 - Antitoxin
OO879_RS22000 (4378915) 4378915..4380186 + 1272 WP_001301684.1 aromatic amino acid transport family protein -
OO879_RS22005 (4380216) 4380216..4381220 - 1005 WP_000107027.1 dipeptide ABC transporter ATP-binding subunit DppF -
OO879_RS22010 (4381217) 4381217..4382200 - 984 WP_001196486.1 dipeptide ABC transporter ATP-binding protein -
OO879_RS22015 (4382211) 4382211..4383113 - 903 WP_000084677.1 dipeptide ABC transporter permease DppC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3882.70 Da        Isoelectric Point: 9.0157

>T42447 WP_001295224.1 NZ_AP026118:c4378439-4378332 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK

Download         Length: 108 bp

>T42447 NZ_AP026118:c4378439-4378332 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA

Antitoxin


Download         Length: 66 bp

>AT42447 NZ_AP026118:4378488-4378553 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TSJ7

Antitoxin

Download structure file

References