Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2030394..2030619 | Replicon | chromosome |
| Accession | NZ_AP026118 | ||
| Organism | Escherichia coli strain CEC13004 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
| Locus tag | OO879_RS09915 | Protein ID | WP_000813258.1 |
| Coordinates | 2030394..2030549 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 2030561..2030619 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OO879_RS09865 | 2025396..2025824 | - | 429 | WP_001303509.1 | tellurite resistance protein | - |
| OO879_RS09880 | 2026279..2026992 | - | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
| OO879_RS09885 | 2027128..2027325 | - | 198 | WP_000917763.1 | hypothetical protein | - |
| OO879_RS09890 | 2027550..2028104 | - | 555 | WP_000640035.1 | DUF1133 family protein | - |
| OO879_RS09895 | 2028167..2028472 | - | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
| OO879_RS09900 | 2028485..2029534 | - | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
| OO879_RS09905 | 2029536..2029808 | - | 273 | WP_000191870.1 | hypothetical protein | - |
| OO879_RS09910 | 2029930..2030274 | - | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
| OO879_RS09915 | 2030394..2030549 | - | 156 | WP_000813258.1 | Hok/Gef family protein | Toxin |
| - | 2030561..2030619 | + | 59 | - | - | Antitoxin |
| OO879_RS09920 | 2030840..2031397 | - | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
| OO879_RS09925 | 2031399..2031617 | - | 219 | WP_000683609.1 | DUF4014 family protein | - |
| OO879_RS09930 | 2031745..2032056 | - | 312 | WP_001289673.1 | hypothetical protein | - |
| OO879_RS09935 | 2032049..2032276 | - | 228 | WP_000699809.1 | hypothetical protein | - |
| OO879_RS09940 | 2032273..2032554 | - | 282 | WP_000603384.1 | DNA-binding protein | - |
| OO879_RS09945 | 2032587..2033303 | - | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
| OO879_RS09950 | 2033337..2033798 | - | 462 | WP_000139447.1 | replication protein P | - |
| OO879_RS09955 | 2033791..2034834 | - | 1044 | WP_001262402.1 | DnaT-like ssDNA-binding domain-containing protein | - |
| OO879_RS09960 | 2034903..2035328 | - | 426 | WP_000693878.1 | toxin YdaT family protein | - |
| OO879_RS09965 | 2035312..2035554 | - | 243 | WP_000747948.1 | Cro/CI family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | nleG7' | 1992947..2099005 | 106058 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T42429 WP_000813258.1 NZ_AP026118:c2030549-2030394 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
>T42429 NZ_AP026118:c2030549-2030394 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
Antitoxin
Download Length: 59 bp
>AT42429 NZ_AP026118:2030561-2030619 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|