Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 1180720..1180945 | Replicon | chromosome |
Accession | NZ_AP026118 | ||
Organism | Escherichia coli strain CEC13004 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | - |
Locus tag | OO879_RS05485 | Protein ID | WP_000813263.1 |
Coordinates | 1180790..1180945 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 1180720..1180778 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OO879_RS05455 | 1175995..1177086 | + | 1092 | WP_001205823.1 | hypothetical protein | - |
OO879_RS05460 | 1177093..1177839 | + | 747 | WP_000788745.1 | ATP-binding protein | - |
OO879_RS05465 | 1177861..1178631 | + | 771 | WP_000450992.1 | DUF1627 domain-containing protein | - |
OO879_RS05470 | 1178647..1179060 | + | 414 | WP_001151233.1 | DUF977 family protein | - |
OO879_RS05475 | 1179412..1180185 | - | 774 | WP_000160654.1 | alpha/beta hydrolase | - |
- | 1180720..1180778 | - | 59 | - | - | Antitoxin |
OO879_RS05485 | 1180790..1180945 | + | 156 | WP_000813263.1 | type I toxin-antitoxin system toxin HokD | Toxin |
OO879_RS05490 | 1181113..1181391 | + | 279 | WP_001341388.1 | hypothetical protein | - |
OO879_RS05495 | 1181393..1182442 | + | 1050 | WP_001265172.1 | DUF968 domain-containing protein | - |
OO879_RS05500 | 1182455..1182826 | + | 372 | WP_001217436.1 | RusA family crossover junction endodeoxyribonuclease | - |
OO879_RS05505 | 1182816..1183187 | + | 372 | WP_000090264.1 | antiterminator Q family protein | - |
OO879_RS05510 | 1183339..1184157 | + | 819 | WP_000265265.1 | CPBP family intramembrane metalloprotease | - |
OO879_RS05515 | 1184444..1184640 | + | 197 | Protein_1080 | TrmB family transcriptional regulator | - |
OO879_RS05520 | 1184778..1185491 | + | 714 | WP_000261909.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5722.86 Da Isoelectric Point: 6.1531
>T42423 WP_000813263.1 NZ_AP026118:1180790-1180945 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T42423 NZ_AP026118:1180790-1180945 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT42423 NZ_AP026118:c1180778-1180720 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|