Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-ohsC/Ldr(toxin) |
Location | 4357135..4357356 | Replicon | chromosome |
Accession | NZ_AP026116 | ||
Organism | Escherichia coli strain CEC13002 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1NWX0 |
Locus tag | OO850_RS21910 | Protein ID | WP_001295224.1 |
Coordinates | 4357135..4357242 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | ohsC | ||
Locus tag | - | ||
Coordinates | 4357291..4357356 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OO850_RS21885 (4352388) | 4352388..4353140 | - | 753 | Protein_4286 | cellulose biosynthesis protein BcsQ | - |
OO850_RS21890 (4353152) | 4353152..4353340 | - | 189 | WP_001063316.1 | cellulose biosynthesis protein BcsR | - |
OO850_RS21895 (4353613) | 4353613..4355184 | + | 1572 | WP_001204920.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
OO850_RS21900 (4355181) | 4355181..4355372 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
OO850_RS21905 (4355369) | 4355369..4357048 | + | 1680 | WP_000191596.1 | cellulose biosynthesis protein BcsG | - |
OO850_RS21910 (4357135) | 4357135..4357242 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- (4357291) | 4357291..4357356 | + | 66 | NuclAT_16 | - | Antitoxin |
- (4357291) | 4357291..4357356 | + | 66 | NuclAT_16 | - | Antitoxin |
- (4357291) | 4357291..4357356 | + | 66 | NuclAT_16 | - | Antitoxin |
- (4357291) | 4357291..4357356 | + | 66 | NuclAT_16 | - | Antitoxin |
- (4357291) | 4357291..4357356 | + | 66 | NuclAT_21 | - | Antitoxin |
- (4357291) | 4357291..4357356 | + | 66 | NuclAT_21 | - | Antitoxin |
- (4357291) | 4357291..4357356 | + | 66 | NuclAT_21 | - | Antitoxin |
- (4357291) | 4357291..4357356 | + | 66 | NuclAT_21 | - | Antitoxin |
OO850_RS21915 (4357718) | 4357718..4358989 | + | 1272 | WP_001301684.1 | aromatic amino acid transport family protein | - |
OO850_RS21920 (4359019) | 4359019..4360023 | - | 1005 | WP_000107027.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
OO850_RS21925 (4360020) | 4360020..4361003 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
OO850_RS21930 (4361014) | 4361014..4361916 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T42408 WP_001295224.1 NZ_AP026116:c4357242-4357135 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T42408 NZ_AP026116:c4357242-4357135 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 66 bp
>AT42408 NZ_AP026116:4357291-4357356 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|