Detailed information of TA system TA042389

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-rdlD/Ldr(toxin)
• Location: 1609618..1609832
• Replicon: chromosome
• Accession: NZ_AP026116
• Organism: Escherichia coli strain CEC13002

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: J7R083
• Locus tag: OO850_RS07765
• Protein ID: WP_000170963.1
• Coordinates: 1609618..1609725 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	rdlD
Locus tag	-
Coordinates	1609773..1609832 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
OO850_RS07735 (1604927)	1604927..1606009	+	1083	WP_000804726.1	peptide chain release factor 1	-
OO850_RS07740 (1606009)	1606009..1606842	+	834	WP_000456466.1	peptide chain release factor N(5)-glutamine methyltransferase	-
OO850_RS07745 (1606839)	1606839..1607231	+	393	WP_000200379.1	invasion regulator SirB2	-
OO850_RS07750 (1607235)	1607235..1608044	+	810	WP_001257044.1	invasion regulator SirB1	-
OO850_RS07755 (1608080)	1608080..1608934	+	855	WP_000811067.1	3-deoxy-8-phosphooctulonate synthase	-
OO850_RS07760 (1609082)	1609082..1609189	-	108	WP_000170954.1	type I toxin-antitoxin system toxin Ldr family protein	-
- (1609242)	1609242..1609303	+	62	NuclAT_24	-	-
- (1609242)	1609242..1609303	+	62	NuclAT_24	-	-
- (1609242)	1609242..1609303	+	62	NuclAT_24	-	-
- (1609242)	1609242..1609303	+	62	NuclAT_24	-	-
- (1609242)	1609242..1609303	+	62	NuclAT_26	-	-
- (1609242)	1609242..1609303	+	62	NuclAT_26	-	-
- (1609242)	1609242..1609303	+	62	NuclAT_26	-	-
- (1609242)	1609242..1609303	+	62	NuclAT_26	-	-
- (1609242)	1609242..1609303	+	62	NuclAT_28	-	-
- (1609242)	1609242..1609303	+	62	NuclAT_28	-	-
- (1609242)	1609242..1609303	+	62	NuclAT_28	-	-
- (1609242)	1609242..1609303	+	62	NuclAT_28	-	-
- (1609242)	1609242..1609303	+	62	NuclAT_30	-	-
- (1609242)	1609242..1609303	+	62	NuclAT_30	-	-
- (1609242)	1609242..1609303	+	62	NuclAT_30	-	-
- (1609242)	1609242..1609303	+	62	NuclAT_30	-	-
- (1609242)	1609242..1609303	+	62	NuclAT_32	-	-
- (1609242)	1609242..1609303	+	62	NuclAT_32	-	-
- (1609242)	1609242..1609303	+	62	NuclAT_32	-	-
- (1609242)	1609242..1609303	+	62	NuclAT_32	-	-
- (1609242)	1609242..1609304	+	63	NuclAT_17	-	-
- (1609242)	1609242..1609304	+	63	NuclAT_17	-	-
- (1609242)	1609242..1609304	+	63	NuclAT_17	-	-
- (1609242)	1609242..1609304	+	63	NuclAT_17	-	-
- (1609242)	1609242..1609304	+	63	NuclAT_18	-	-
- (1609242)	1609242..1609304	+	63	NuclAT_18	-	-
- (1609242)	1609242..1609304	+	63	NuclAT_18	-	-
- (1609242)	1609242..1609304	+	63	NuclAT_18	-	-
- (1609242)	1609242..1609304	+	63	NuclAT_19	-	-
- (1609242)	1609242..1609304	+	63	NuclAT_19	-	-
- (1609242)	1609242..1609304	+	63	NuclAT_19	-	-
- (1609242)	1609242..1609304	+	63	NuclAT_19	-	-
- (1609242)	1609242..1609304	+	63	NuclAT_20	-	-
- (1609242)	1609242..1609304	+	63	NuclAT_20	-	-
- (1609242)	1609242..1609304	+	63	NuclAT_20	-	-
- (1609242)	1609242..1609304	+	63	NuclAT_20	-	-
- (1609242)	1609242..1609304	+	63	NuclAT_22	-	-
- (1609242)	1609242..1609304	+	63	NuclAT_22	-	-
- (1609242)	1609242..1609304	+	63	NuclAT_22	-	-
- (1609242)	1609242..1609304	+	63	NuclAT_22	-	-
- (1609242)	1609242..1609304	+	63	NuclAT_23	-	-
- (1609242)	1609242..1609304	+	63	NuclAT_23	-	-
- (1609242)	1609242..1609304	+	63	NuclAT_23	-	-
- (1609242)	1609242..1609304	+	63	NuclAT_23	-	-
OO850_RS07765 (1609618)	1609618..1609725	-	108	WP_000170963.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
- (1609773)	1609773..1609832	+	60	NuclAT_25	-	Antitoxin
- (1609773)	1609773..1609832	+	60	NuclAT_25	-	Antitoxin
- (1609773)	1609773..1609832	+	60	NuclAT_25	-	Antitoxin
- (1609773)	1609773..1609832	+	60	NuclAT_25	-	Antitoxin
- (1609773)	1609773..1609832	+	60	NuclAT_27	-	Antitoxin
- (1609773)	1609773..1609832	+	60	NuclAT_27	-	Antitoxin
- (1609773)	1609773..1609832	+	60	NuclAT_27	-	Antitoxin
- (1609773)	1609773..1609832	+	60	NuclAT_27	-	Antitoxin
- (1609773)	1609773..1609832	+	60	NuclAT_29	-	Antitoxin
- (1609773)	1609773..1609832	+	60	NuclAT_29	-	Antitoxin
- (1609773)	1609773..1609832	+	60	NuclAT_29	-	Antitoxin
- (1609773)	1609773..1609832	+	60	NuclAT_29	-	Antitoxin
- (1609773)	1609773..1609832	+	60	NuclAT_31	-	Antitoxin
- (1609773)	1609773..1609832	+	60	NuclAT_31	-	Antitoxin
- (1609773)	1609773..1609832	+	60	NuclAT_31	-	Antitoxin
- (1609773)	1609773..1609832	+	60	NuclAT_31	-	Antitoxin
- (1609773)	1609773..1609832	+	60	NuclAT_33	-	Antitoxin
- (1609773)	1609773..1609832	+	60	NuclAT_33	-	Antitoxin
- (1609773)	1609773..1609832	+	60	NuclAT_33	-	Antitoxin
- (1609773)	1609773..1609832	+	60	NuclAT_33	-	Antitoxin
OO850_RS07770 (1610124)	1610124..1611224	-	1101	WP_001301956.1	sodium-potassium/proton antiporter ChaA	-
OO850_RS07775 (1611494)	1611494..1611724	+	231	WP_001146444.1	putative cation transport regulator ChaB	-
OO850_RS07780 (1611885)	1611885..1612580	+	696	WP_001301489.1	glutathione-specific gamma-glutamylcyclotransferase	-
OO850_RS07785 (1612624)	1612624..1612977	-	354	WP_001169661.1	DsrE/F sulfur relay family protein YchN	-
OO850_RS07790 (1613163)	1613163..1614557	+	1395	WP_000086192.1	inverse autotransporter invasin YchO	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 3971.74 Da
• Isoelectric Point: 11.4779

>T42389 WP_000170963.1 NZ_AP026116:c1609725-1609618 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Nucleotide

• Length: 108 bp

>T42389 NZ_AP026116:c1609725-1609618 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin

Nucleotide

• Length: 60 bp

>AT42389 NZ_AP026116:1609773-1609832 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Structures

Antitoxin