Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-ohsC/Ldr(toxin)
Location 4303161..4303382 Replicon chromosome
Accession NZ_AP026114
Organism Escherichia coli strain CEC01302

Toxin (Protein)


Gene name ldrD Uniprot ID S1NWX0
Locus tag OO829_RS21445 Protein ID WP_001295224.1
Coordinates 4303161..4303268 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name ohsC
Locus tag -
Coordinates 4303317..4303382 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OO829_RS21420 (4298414) 4298414..4299166 - 753 Protein_4196 cellulose biosynthesis protein BcsQ -
OO829_RS21425 (4299178) 4299178..4299366 - 189 WP_001063316.1 cellulose biosynthesis protein BcsR -
OO829_RS21430 (4299639) 4299639..4301210 + 1572 WP_001204920.1 cellulose biosynthesis c-di-GMP-binding protein BcsE -
OO829_RS21435 (4301207) 4301207..4301398 + 192 WP_000988308.1 cellulose biosynthesis protein BcsF -
OO829_RS21440 (4301395) 4301395..4303074 + 1680 WP_000191596.1 cellulose biosynthesis protein BcsG -
OO829_RS21445 (4303161) 4303161..4303268 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (4303317) 4303317..4303382 + 66 NuclAT_16 - Antitoxin
- (4303317) 4303317..4303382 + 66 NuclAT_16 - Antitoxin
- (4303317) 4303317..4303382 + 66 NuclAT_16 - Antitoxin
- (4303317) 4303317..4303382 + 66 NuclAT_16 - Antitoxin
- (4303317) 4303317..4303382 + 66 NuclAT_21 - Antitoxin
- (4303317) 4303317..4303382 + 66 NuclAT_21 - Antitoxin
- (4303317) 4303317..4303382 + 66 NuclAT_21 - Antitoxin
- (4303317) 4303317..4303382 + 66 NuclAT_21 - Antitoxin
OO829_RS21450 (4303744) 4303744..4305015 + 1272 WP_001301684.1 aromatic amino acid transport family protein -
OO829_RS21455 (4305045) 4305045..4306049 - 1005 WP_000107027.1 dipeptide ABC transporter ATP-binding subunit DppF -
OO829_RS21460 (4306046) 4306046..4307029 - 984 WP_001196486.1 dipeptide ABC transporter ATP-binding protein -
OO829_RS21465 (4307040) 4307040..4307942 - 903 WP_000084677.1 dipeptide ABC transporter permease DppC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3882.70 Da        Isoelectric Point: 9.0157

>T42373 WP_001295224.1 NZ_AP026114:c4303268-4303161 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK

Download         Length: 108 bp

>T42373 NZ_AP026114:c4303268-4303161 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA

Antitoxin


Download         Length: 66 bp

>AT42373 NZ_AP026114:4303317-4303382 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TSJ7

Antitoxin

Download structure file

References