Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2074543..2074768 | Replicon | chromosome |
Accession | NZ_AP026112 | ||
Organism | Escherichia coli strain CEC03102 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
Locus tag | OO877_RS10210 | Protein ID | WP_000813258.1 |
Coordinates | 2074543..2074698 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 2074710..2074768 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OO877_RS10160 | 2069546..2069977 | - | 432 | WP_001302123.1 | tellurite resistance protein | - |
OO877_RS10175 | 2070428..2071141 | - | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
OO877_RS10180 | 2071277..2071474 | - | 198 | WP_000917763.1 | hypothetical protein | - |
OO877_RS10185 | 2071699..2072253 | - | 555 | WP_000640035.1 | DUF1133 family protein | - |
OO877_RS10190 | 2072316..2072621 | - | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
OO877_RS10195 | 2072634..2073683 | - | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
OO877_RS10200 | 2073685..2073957 | - | 273 | WP_000191871.1 | hypothetical protein | - |
OO877_RS10205 | 2074079..2074423 | - | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
OO877_RS10210 | 2074543..2074698 | - | 156 | WP_000813258.1 | Hok/Gef family protein | Toxin |
- | 2074710..2074768 | + | 59 | - | - | Antitoxin |
OO877_RS10215 | 2074989..2075546 | - | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
OO877_RS10220 | 2075548..2075766 | - | 219 | WP_000683609.1 | DUF4014 family protein | - |
OO877_RS10225 | 2075894..2076205 | - | 312 | WP_001289673.1 | hypothetical protein | - |
OO877_RS10230 | 2076198..2076425 | - | 228 | WP_000699809.1 | hypothetical protein | - |
OO877_RS10235 | 2076422..2076703 | - | 282 | WP_000603384.1 | DNA-binding protein | - |
OO877_RS10240 | 2076736..2077452 | - | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
OO877_RS10245 | 2077486..2077947 | - | 462 | WP_000139447.1 | replication protein P | - |
OO877_RS10250 | 2077940..2078995 | - | 1056 | WP_001356791.1 | DnaT-like ssDNA-binding domain-containing protein | - |
OO877_RS10255 | 2079064..2079489 | - | 426 | WP_000693878.1 | toxin YdaT family protein | - |
OO877_RS10260 | 2079473..2079716 | - | 244 | Protein_2015 | Cro/CI family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | nleG7' | 2037097..2134133 | 97036 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T42322 WP_000813258.1 NZ_AP026112:c2074698-2074543 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
>T42322 NZ_AP026112:c2074698-2074543 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
Antitoxin
Download Length: 59 bp
>AT42322 NZ_AP026112:2074710-2074768 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|