Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 1721578..1721803 | Replicon | chromosome |
| Accession | NZ_AP026110 | ||
| Organism | Escherichia coli strain CEC08123 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
| Locus tag | OO855_RS08535 | Protein ID | WP_000813258.1 |
| Coordinates | 1721648..1721803 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 1721578..1721636 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OO855_RS08485 | 1716630..1716873 | + | 244 | Protein_1663 | Cro/CI family transcriptional regulator | - |
| OO855_RS08490 | 1716857..1717282 | + | 426 | WP_000693878.1 | toxin YdaT family protein | - |
| OO855_RS08495 | 1717351..1718406 | + | 1056 | WP_001356791.1 | DnaT-like ssDNA-binding domain-containing protein | - |
| OO855_RS08500 | 1718399..1718860 | + | 462 | WP_000139447.1 | replication protein P | - |
| OO855_RS08505 | 1718894..1719610 | + | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
| OO855_RS08510 | 1719643..1719924 | + | 282 | WP_000603384.1 | DNA-binding protein | - |
| OO855_RS08515 | 1719921..1720148 | + | 228 | WP_000699809.1 | hypothetical protein | - |
| OO855_RS08520 | 1720141..1720452 | + | 312 | WP_001289673.1 | hypothetical protein | - |
| OO855_RS08525 | 1720580..1720798 | + | 219 | WP_000683609.1 | DUF4014 family protein | - |
| OO855_RS08530 | 1720800..1721357 | + | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
| - | 1721578..1721636 | - | 59 | - | - | Antitoxin |
| OO855_RS08535 | 1721648..1721803 | + | 156 | WP_000813258.1 | Hok/Gef family protein | Toxin |
| OO855_RS08540 | 1721923..1722267 | + | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
| OO855_RS08545 | 1722389..1722661 | + | 273 | WP_000191871.1 | hypothetical protein | - |
| OO855_RS08550 | 1722663..1723712 | + | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
| OO855_RS08555 | 1723725..1724030 | + | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
| OO855_RS08560 | 1724093..1724647 | + | 555 | WP_000640035.1 | DUF1133 family protein | - |
| OO855_RS08565 | 1724872..1725069 | + | 198 | WP_000917763.1 | hypothetical protein | - |
| OO855_RS08570 | 1725205..1725918 | + | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
| OO855_RS08585 | 1726369..1726800 | + | 432 | WP_001302123.1 | tellurite resistance protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | nleG7' | 1662216..1759250 | 97034 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T42290 WP_000813258.1 NZ_AP026110:1721648-1721803 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
>T42290 NZ_AP026110:1721648-1721803 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
Antitoxin
Download Length: 59 bp
>AT42290 NZ_AP026110:c1721636-1721578 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|