Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-ohsC/Ldr(toxin)
Location 4503579..4503800 Replicon chromosome
Accession NZ_AP026108
Organism Escherichia coli strain CEC13091

Toxin (Protein)


Gene name ldrD Uniprot ID S1NWX0
Locus tag OO842_RS22710 Protein ID WP_001295224.1
Coordinates 4503579..4503686 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name ohsC
Locus tag -
Coordinates 4503735..4503800 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OO842_RS22685 (4498832) 4498832..4499584 - 753 Protein_4448 cellulose biosynthesis protein BcsQ -
OO842_RS22690 (4499596) 4499596..4499784 - 189 WP_001063316.1 cellulose biosynthesis protein BcsR -
OO842_RS22695 (4500057) 4500057..4501628 + 1572 WP_001204920.1 cellulose biosynthesis c-di-GMP-binding protein BcsE -
OO842_RS22700 (4501625) 4501625..4501816 + 192 WP_000988308.1 cellulose biosynthesis protein BcsF -
OO842_RS22705 (4501813) 4501813..4503492 + 1680 WP_000191596.1 cellulose biosynthesis protein BcsG -
OO842_RS22710 (4503579) 4503579..4503686 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (4503735) 4503735..4503800 + 66 NuclAT_16 - Antitoxin
- (4503735) 4503735..4503800 + 66 NuclAT_16 - Antitoxin
- (4503735) 4503735..4503800 + 66 NuclAT_16 - Antitoxin
- (4503735) 4503735..4503800 + 66 NuclAT_16 - Antitoxin
- (4503735) 4503735..4503800 + 66 NuclAT_21 - Antitoxin
- (4503735) 4503735..4503800 + 66 NuclAT_21 - Antitoxin
- (4503735) 4503735..4503800 + 66 NuclAT_21 - Antitoxin
- (4503735) 4503735..4503800 + 66 NuclAT_21 - Antitoxin
OO842_RS22715 (4504162) 4504162..4505433 + 1272 WP_001301684.1 aromatic amino acid transport family protein -
OO842_RS22720 (4505463) 4505463..4506467 - 1005 WP_000107027.1 dipeptide ABC transporter ATP-binding subunit DppF -
OO842_RS22725 (4506464) 4506464..4507447 - 984 WP_001196486.1 dipeptide ABC transporter ATP-binding protein -
OO842_RS22730 (4507458) 4507458..4508360 - 903 WP_000084677.1 dipeptide ABC transporter permease DppC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3882.70 Da        Isoelectric Point: 9.0157

>T42264 WP_001295224.1 NZ_AP026108:c4503686-4503579 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK

Download         Length: 108 bp

>T42264 NZ_AP026108:c4503686-4503579 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA

Antitoxin


Download         Length: 66 bp

>AT42264 NZ_AP026108:4503735-4503800 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TSJ7

Antitoxin

Download structure file

References