Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2162376..2162601 | Replicon | chromosome |
Accession | NZ_AP026108 | ||
Organism | Escherichia coli strain CEC13091 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
Locus tag | OO842_RS10720 | Protein ID | WP_000813258.1 |
Coordinates | 2162376..2162531 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 2162543..2162601 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OO842_RS10670 | 2157379..2157810 | - | 432 | WP_001302123.1 | tellurite resistance protein | - |
OO842_RS10685 | 2158261..2158974 | - | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
OO842_RS10690 | 2159110..2159307 | - | 198 | WP_000917763.1 | hypothetical protein | - |
OO842_RS10695 | 2159532..2160086 | - | 555 | WP_000640035.1 | DUF1133 family protein | - |
OO842_RS10700 | 2160149..2160454 | - | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
OO842_RS10705 | 2160467..2161516 | - | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
OO842_RS10710 | 2161518..2161790 | - | 273 | WP_000191871.1 | hypothetical protein | - |
OO842_RS10715 | 2161912..2162256 | - | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
OO842_RS10720 | 2162376..2162531 | - | 156 | WP_000813258.1 | Hok/Gef family protein | Toxin |
- | 2162543..2162601 | + | 59 | - | - | Antitoxin |
OO842_RS10725 | 2162822..2163379 | - | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
OO842_RS10730 | 2163381..2163599 | - | 219 | WP_000683609.1 | DUF4014 family protein | - |
OO842_RS10735 | 2163727..2164038 | - | 312 | WP_001289673.1 | hypothetical protein | - |
OO842_RS10740 | 2164031..2164258 | - | 228 | WP_000699809.1 | hypothetical protein | - |
OO842_RS10745 | 2164255..2164536 | - | 282 | WP_000603384.1 | DNA-binding protein | - |
OO842_RS10750 | 2164569..2165285 | - | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
OO842_RS10755 | 2165319..2165780 | - | 462 | WP_000139447.1 | replication protein P | - |
OO842_RS10760 | 2165773..2166828 | - | 1056 | WP_001356791.1 | DnaT-like ssDNA-binding domain-containing protein | - |
OO842_RS10765 | 2166897..2167322 | - | 426 | WP_000693878.1 | toxin YdaT family protein | - |
OO842_RS10770 | 2167306..2167549 | - | 244 | Protein_2117 | Cro/CI family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | nleG7' | 2124929..2223088 | 98159 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T42246 WP_000813258.1 NZ_AP026108:c2162531-2162376 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
>T42246 NZ_AP026108:c2162531-2162376 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
Antitoxin
Download Length: 59 bp
>AT42246 NZ_AP026108:2162543-2162601 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|