Detailed information of TA system TA042243

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-rdlD/Ldr(toxin)
• Location: 1735072..1735286
• Replicon: chromosome
• Accession: NZ_AP026108
• Organism: Escherichia coli strain CEC13091

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: J7R083
• Locus tag: OO842_RS08560
• Protein ID: WP_000170963.1
• Coordinates: 1735072..1735179 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	rdlD
Locus tag	-
Coordinates	1735227..1735286 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
OO842_RS08530 (1730381)	1730381..1731463	+	1083	WP_000804726.1	peptide chain release factor 1	-
OO842_RS08535 (1731463)	1731463..1732296	+	834	WP_000456466.1	peptide chain release factor N(5)-glutamine methyltransferase	-
OO842_RS08540 (1732293)	1732293..1732685	+	393	WP_000200379.1	invasion regulator SirB2	-
OO842_RS08545 (1732689)	1732689..1733498	+	810	WP_001257044.1	invasion regulator SirB1	-
OO842_RS08550 (1733534)	1733534..1734388	+	855	WP_000811067.1	3-deoxy-8-phosphooctulonate synthase	-
OO842_RS08555 (1734536)	1734536..1734643	-	108	WP_000170954.1	type I toxin-antitoxin system toxin Ldr family protein	-
- (1734696)	1734696..1734757	+	62	NuclAT_24	-	-
- (1734696)	1734696..1734757	+	62	NuclAT_24	-	-
- (1734696)	1734696..1734757	+	62	NuclAT_24	-	-
- (1734696)	1734696..1734757	+	62	NuclAT_24	-	-
- (1734696)	1734696..1734757	+	62	NuclAT_26	-	-
- (1734696)	1734696..1734757	+	62	NuclAT_26	-	-
- (1734696)	1734696..1734757	+	62	NuclAT_26	-	-
- (1734696)	1734696..1734757	+	62	NuclAT_26	-	-
- (1734696)	1734696..1734757	+	62	NuclAT_28	-	-
- (1734696)	1734696..1734757	+	62	NuclAT_28	-	-
- (1734696)	1734696..1734757	+	62	NuclAT_28	-	-
- (1734696)	1734696..1734757	+	62	NuclAT_28	-	-
- (1734696)	1734696..1734757	+	62	NuclAT_30	-	-
- (1734696)	1734696..1734757	+	62	NuclAT_30	-	-
- (1734696)	1734696..1734757	+	62	NuclAT_30	-	-
- (1734696)	1734696..1734757	+	62	NuclAT_30	-	-
- (1734696)	1734696..1734757	+	62	NuclAT_32	-	-
- (1734696)	1734696..1734757	+	62	NuclAT_32	-	-
- (1734696)	1734696..1734757	+	62	NuclAT_32	-	-
- (1734696)	1734696..1734757	+	62	NuclAT_32	-	-
- (1734696)	1734696..1734758	+	63	NuclAT_17	-	-
- (1734696)	1734696..1734758	+	63	NuclAT_17	-	-
- (1734696)	1734696..1734758	+	63	NuclAT_17	-	-
- (1734696)	1734696..1734758	+	63	NuclAT_17	-	-
- (1734696)	1734696..1734758	+	63	NuclAT_18	-	-
- (1734696)	1734696..1734758	+	63	NuclAT_18	-	-
- (1734696)	1734696..1734758	+	63	NuclAT_18	-	-
- (1734696)	1734696..1734758	+	63	NuclAT_18	-	-
- (1734696)	1734696..1734758	+	63	NuclAT_19	-	-
- (1734696)	1734696..1734758	+	63	NuclAT_19	-	-
- (1734696)	1734696..1734758	+	63	NuclAT_19	-	-
- (1734696)	1734696..1734758	+	63	NuclAT_19	-	-
- (1734696)	1734696..1734758	+	63	NuclAT_20	-	-
- (1734696)	1734696..1734758	+	63	NuclAT_20	-	-
- (1734696)	1734696..1734758	+	63	NuclAT_20	-	-
- (1734696)	1734696..1734758	+	63	NuclAT_20	-	-
- (1734696)	1734696..1734758	+	63	NuclAT_22	-	-
- (1734696)	1734696..1734758	+	63	NuclAT_22	-	-
- (1734696)	1734696..1734758	+	63	NuclAT_22	-	-
- (1734696)	1734696..1734758	+	63	NuclAT_22	-	-
- (1734696)	1734696..1734758	+	63	NuclAT_23	-	-
- (1734696)	1734696..1734758	+	63	NuclAT_23	-	-
- (1734696)	1734696..1734758	+	63	NuclAT_23	-	-
- (1734696)	1734696..1734758	+	63	NuclAT_23	-	-
OO842_RS08560 (1735072)	1735072..1735179	-	108	WP_000170963.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
- (1735227)	1735227..1735286	+	60	NuclAT_25	-	Antitoxin
- (1735227)	1735227..1735286	+	60	NuclAT_25	-	Antitoxin
- (1735227)	1735227..1735286	+	60	NuclAT_25	-	Antitoxin
- (1735227)	1735227..1735286	+	60	NuclAT_25	-	Antitoxin
- (1735227)	1735227..1735286	+	60	NuclAT_27	-	Antitoxin
- (1735227)	1735227..1735286	+	60	NuclAT_27	-	Antitoxin
- (1735227)	1735227..1735286	+	60	NuclAT_27	-	Antitoxin
- (1735227)	1735227..1735286	+	60	NuclAT_27	-	Antitoxin
- (1735227)	1735227..1735286	+	60	NuclAT_29	-	Antitoxin
- (1735227)	1735227..1735286	+	60	NuclAT_29	-	Antitoxin
- (1735227)	1735227..1735286	+	60	NuclAT_29	-	Antitoxin
- (1735227)	1735227..1735286	+	60	NuclAT_29	-	Antitoxin
- (1735227)	1735227..1735286	+	60	NuclAT_31	-	Antitoxin
- (1735227)	1735227..1735286	+	60	NuclAT_31	-	Antitoxin
- (1735227)	1735227..1735286	+	60	NuclAT_31	-	Antitoxin
- (1735227)	1735227..1735286	+	60	NuclAT_31	-	Antitoxin
- (1735227)	1735227..1735286	+	60	NuclAT_33	-	Antitoxin
- (1735227)	1735227..1735286	+	60	NuclAT_33	-	Antitoxin
- (1735227)	1735227..1735286	+	60	NuclAT_33	-	Antitoxin
- (1735227)	1735227..1735286	+	60	NuclAT_33	-	Antitoxin
OO842_RS08565 (1735578)	1735578..1736678	-	1101	WP_001301956.1	sodium-potassium/proton antiporter ChaA	-
OO842_RS08570 (1736948)	1736948..1737178	+	231	WP_001146444.1	putative cation transport regulator ChaB	-
OO842_RS08575 (1737339)	1737339..1738034	+	696	WP_001453713.1	glutathione-specific gamma-glutamylcyclotransferase	-
OO842_RS08580 (1738078)	1738078..1738431	-	354	WP_001169661.1	DsrE/F sulfur relay family protein YchN	-
OO842_RS08585 (1738617)	1738617..1740011	+	1395	WP_000086192.1	inverse autotransporter invasin YchO	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 3971.74 Da
• Isoelectric Point: 11.4779

>T42243 WP_000170963.1 NZ_AP026108:c1735179-1735072 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Nucleotide

• Length: 108 bp

>T42243 NZ_AP026108:c1735179-1735072 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin

Nucleotide

• Length: 60 bp

>AT42243 NZ_AP026108:1735227-1735286 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Structures

Antitoxin