Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 1251704..1251929 | Replicon | chromosome |
| Accession | NZ_AP026108 | ||
| Organism | Escherichia coli strain CEC13091 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | - |
| Locus tag | OO842_RS05875 | Protein ID | WP_000813263.1 |
| Coordinates | 1251774..1251929 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 1251704..1251762 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OO842_RS05845 | 1246979..1248070 | + | 1092 | WP_001205823.1 | hypothetical protein | - |
| OO842_RS05850 | 1248077..1248823 | + | 747 | WP_000788745.1 | ATP-binding protein | - |
| OO842_RS05855 | 1248845..1249615 | + | 771 | WP_000450992.1 | DUF1627 domain-containing protein | - |
| OO842_RS05860 | 1249631..1250044 | + | 414 | WP_001151233.1 | DUF977 family protein | - |
| OO842_RS05865 | 1250396..1251169 | - | 774 | WP_000160654.1 | alpha/beta hydrolase | - |
| - | 1251704..1251762 | - | 59 | - | - | Antitoxin |
| OO842_RS05875 | 1251774..1251929 | + | 156 | WP_000813263.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| OO842_RS05880 | 1252097..1252375 | + | 279 | WP_001341388.1 | hypothetical protein | - |
| OO842_RS05885 | 1252377..1253426 | + | 1050 | WP_001265172.1 | DUF968 domain-containing protein | - |
| OO842_RS05890 | 1253439..1253810 | + | 372 | WP_001217436.1 | RusA family crossover junction endodeoxyribonuclease | - |
| OO842_RS05895 | 1253800..1254171 | + | 372 | WP_000090264.1 | antiterminator Q family protein | - |
| OO842_RS05900 | 1254323..1255141 | + | 819 | WP_000265265.1 | CPBP family intramembrane metalloprotease | - |
| OO842_RS05905 | 1255428..1255624 | + | 197 | Protein_1158 | TrmB family transcriptional regulator | - |
| OO842_RS05910 | 1255762..1256475 | + | 714 | WP_000261909.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5722.86 Da Isoelectric Point: 6.1531
>T42240 WP_000813263.1 NZ_AP026108:1251774-1251929 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T42240 NZ_AP026108:1251774-1251929 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT42240 NZ_AP026108:c1251762-1251704 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|