Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-ohsC/Ldr(toxin)
Location 4306753..4306974 Replicon chromosome
Accession NZ_AP026106
Organism Escherichia coli strain CEC01311

Toxin (Protein)


Gene name ldrD Uniprot ID S1NWX0
Locus tag OO831_RS21415 Protein ID WP_001295224.1
Coordinates 4306753..4306860 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name ohsC
Locus tag -
Coordinates 4306909..4306974 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OO831_RS21390 (4302006) 4302006..4302758 - 753 Protein_4192 cellulose biosynthesis protein BcsQ -
OO831_RS21395 (4302770) 4302770..4302958 - 189 WP_001063316.1 cellulose biosynthesis protein BcsR -
OO831_RS21400 (4303231) 4303231..4304802 + 1572 WP_001204920.1 cellulose biosynthesis c-di-GMP-binding protein BcsE -
OO831_RS21405 (4304799) 4304799..4304990 + 192 WP_000988308.1 cellulose biosynthesis protein BcsF -
OO831_RS21410 (4304987) 4304987..4306666 + 1680 WP_000191596.1 cellulose biosynthesis protein BcsG -
OO831_RS21415 (4306753) 4306753..4306860 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (4306909) 4306909..4306974 + 66 NuclAT_16 - Antitoxin
- (4306909) 4306909..4306974 + 66 NuclAT_16 - Antitoxin
- (4306909) 4306909..4306974 + 66 NuclAT_16 - Antitoxin
- (4306909) 4306909..4306974 + 66 NuclAT_16 - Antitoxin
- (4306909) 4306909..4306974 + 66 NuclAT_21 - Antitoxin
- (4306909) 4306909..4306974 + 66 NuclAT_21 - Antitoxin
- (4306909) 4306909..4306974 + 66 NuclAT_21 - Antitoxin
- (4306909) 4306909..4306974 + 66 NuclAT_21 - Antitoxin
OO831_RS21420 (4307336) 4307336..4308607 + 1272 WP_001301684.1 aromatic amino acid transport family protein -
OO831_RS21425 (4308637) 4308637..4309641 - 1005 WP_000107027.1 dipeptide ABC transporter ATP-binding subunit DppF -
OO831_RS21430 (4309638) 4309638..4310621 - 984 WP_001196486.1 dipeptide ABC transporter ATP-binding protein -
OO831_RS21435 (4310632) 4310632..4311534 - 903 WP_000084677.1 dipeptide ABC transporter permease DppC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3882.70 Da        Isoelectric Point: 9.0157

>T42224 WP_001295224.1 NZ_AP026106:c4306860-4306753 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK

Download         Length: 108 bp

>T42224 NZ_AP026106:c4306860-4306753 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA

Antitoxin


Download         Length: 66 bp

>AT42224 NZ_AP026106:4306909-4306974 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TSJ7

Antitoxin

Download structure file

References