Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2004374..2004599 | Replicon | chromosome |
Accession | NZ_AP026106 | ||
Organism | Escherichia coli strain CEC01311 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
Locus tag | OO831_RS09730 | Protein ID | WP_000813258.1 |
Coordinates | 2004374..2004529 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 2004541..2004599 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OO831_RS09680 | 1999377..1999808 | - | 432 | WP_001302123.1 | tellurite resistance protein | - |
OO831_RS09680 | 1999377..1999808 | - | 432 | WP_001302123.1 | tellurite resistance protein | - |
OO831_RS09695 | 2000259..2000972 | - | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
OO831_RS09695 | 2000259..2000972 | - | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
OO831_RS09700 | 2001108..2001305 | - | 198 | WP_000917763.1 | hypothetical protein | - |
OO831_RS09700 | 2001108..2001305 | - | 198 | WP_000917763.1 | hypothetical protein | - |
OO831_RS09705 | 2001530..2002084 | - | 555 | WP_000640035.1 | DUF1133 family protein | - |
OO831_RS09705 | 2001530..2002084 | - | 555 | WP_000640035.1 | DUF1133 family protein | - |
OO831_RS09710 | 2002147..2002452 | - | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
OO831_RS09710 | 2002147..2002452 | - | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
OO831_RS09715 | 2002465..2003514 | - | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
OO831_RS09715 | 2002465..2003514 | - | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
OO831_RS09720 | 2003516..2003788 | - | 273 | WP_000191871.1 | hypothetical protein | - |
OO831_RS09720 | 2003516..2003788 | - | 273 | WP_000191871.1 | hypothetical protein | - |
OO831_RS09725 | 2003910..2004254 | - | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
OO831_RS09725 | 2003910..2004254 | - | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
OO831_RS09730 | 2004374..2004529 | - | 156 | WP_000813258.1 | Hok/Gef family protein | Toxin |
OO831_RS09730 | 2004374..2004529 | - | 156 | WP_000813258.1 | Hok/Gef family protein | Toxin |
- | 2004541..2004599 | + | 59 | - | - | Antitoxin |
OO831_RS09735 | 2004820..2005377 | - | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
OO831_RS09735 | 2004820..2005377 | - | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
OO831_RS09740 | 2005379..2005597 | - | 219 | WP_000683609.1 | DUF4014 family protein | - |
OO831_RS09740 | 2005379..2005597 | - | 219 | WP_000683609.1 | DUF4014 family protein | - |
OO831_RS09745 | 2005725..2006036 | - | 312 | WP_001289673.1 | hypothetical protein | - |
OO831_RS09745 | 2005725..2006036 | - | 312 | WP_001289673.1 | hypothetical protein | - |
OO831_RS09750 | 2006029..2006256 | - | 228 | WP_000699809.1 | hypothetical protein | - |
OO831_RS09750 | 2006029..2006256 | - | 228 | WP_000699809.1 | hypothetical protein | - |
OO831_RS09755 | 2006253..2006534 | - | 282 | WP_000603384.1 | DNA-binding protein | - |
OO831_RS09755 | 2006253..2006534 | - | 282 | WP_000603384.1 | DNA-binding protein | - |
OO831_RS09760 | 2006567..2007283 | - | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
OO831_RS09760 | 2006567..2007283 | - | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
OO831_RS09765 | 2007317..2007778 | - | 462 | WP_000139447.1 | replication protein P | - |
OO831_RS09765 | 2007317..2007778 | - | 462 | WP_000139447.1 | replication protein P | - |
OO831_RS09770 | 2007771..2008826 | - | 1056 | WP_001356791.1 | DnaT-like ssDNA-binding domain-containing protein | - |
OO831_RS09770 | 2007771..2008826 | - | 1056 | WP_001356791.1 | DnaT-like ssDNA-binding domain-containing protein | - |
OO831_RS09775 | 2008895..2009320 | - | 426 | WP_000693878.1 | toxin YdaT family protein | - |
OO831_RS09775 | 2008895..2009320 | - | 426 | WP_000693878.1 | toxin YdaT family protein | - |
OO831_RS09780 | 2009304..2009547 | - | 244 | Protein_1919 | Cro/CI family transcriptional regulator | - |
OO831_RS09780 | 2009304..2009547 | - | 244 | Protein_1919 | Cro/CI family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | nleG7' | 1966928..2071684 | 104756 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T42206 WP_000813258.1 NZ_AP026106:c2004529-2004374 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
>T42206 NZ_AP026106:c2004529-2004374 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
Antitoxin
Download Length: 59 bp
>AT42206 NZ_AP026106:2004541-2004599 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|