Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 1577057..1577271 | Replicon | chromosome |
| Accession | NZ_AP026106 | ||
| Organism | Escherichia coli strain CEC01311 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | J7R083 |
| Locus tag | OO831_RS07570 | Protein ID | WP_000170963.1 |
| Coordinates | 1577057..1577164 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 1577212..1577271 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OO831_RS07540 (1572366) | 1572366..1573448 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| OO831_RS07545 (1573448) | 1573448..1574281 | + | 834 | WP_000456466.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| OO831_RS07550 (1574278) | 1574278..1574670 | + | 393 | WP_000200379.1 | invasion regulator SirB2 | - |
| OO831_RS07555 (1574674) | 1574674..1575483 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| OO831_RS07560 (1575519) | 1575519..1576373 | + | 855 | WP_000811067.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| OO831_RS07565 (1576521) | 1576521..1576628 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (1576681) | 1576681..1576742 | + | 62 | NuclAT_24 | - | - |
| - (1576681) | 1576681..1576742 | + | 62 | NuclAT_24 | - | - |
| - (1576681) | 1576681..1576742 | + | 62 | NuclAT_24 | - | - |
| - (1576681) | 1576681..1576742 | + | 62 | NuclAT_24 | - | - |
| - (1576681) | 1576681..1576742 | + | 62 | NuclAT_26 | - | - |
| - (1576681) | 1576681..1576742 | + | 62 | NuclAT_26 | - | - |
| - (1576681) | 1576681..1576742 | + | 62 | NuclAT_26 | - | - |
| - (1576681) | 1576681..1576742 | + | 62 | NuclAT_26 | - | - |
| - (1576681) | 1576681..1576742 | + | 62 | NuclAT_28 | - | - |
| - (1576681) | 1576681..1576742 | + | 62 | NuclAT_28 | - | - |
| - (1576681) | 1576681..1576742 | + | 62 | NuclAT_28 | - | - |
| - (1576681) | 1576681..1576742 | + | 62 | NuclAT_28 | - | - |
| - (1576681) | 1576681..1576742 | + | 62 | NuclAT_30 | - | - |
| - (1576681) | 1576681..1576742 | + | 62 | NuclAT_30 | - | - |
| - (1576681) | 1576681..1576742 | + | 62 | NuclAT_30 | - | - |
| - (1576681) | 1576681..1576742 | + | 62 | NuclAT_30 | - | - |
| - (1576681) | 1576681..1576742 | + | 62 | NuclAT_32 | - | - |
| - (1576681) | 1576681..1576742 | + | 62 | NuclAT_32 | - | - |
| - (1576681) | 1576681..1576742 | + | 62 | NuclAT_32 | - | - |
| - (1576681) | 1576681..1576742 | + | 62 | NuclAT_32 | - | - |
| - (1576681) | 1576681..1576743 | + | 63 | NuclAT_17 | - | - |
| - (1576681) | 1576681..1576743 | + | 63 | NuclAT_17 | - | - |
| - (1576681) | 1576681..1576743 | + | 63 | NuclAT_17 | - | - |
| - (1576681) | 1576681..1576743 | + | 63 | NuclAT_17 | - | - |
| - (1576681) | 1576681..1576743 | + | 63 | NuclAT_18 | - | - |
| - (1576681) | 1576681..1576743 | + | 63 | NuclAT_18 | - | - |
| - (1576681) | 1576681..1576743 | + | 63 | NuclAT_18 | - | - |
| - (1576681) | 1576681..1576743 | + | 63 | NuclAT_18 | - | - |
| - (1576681) | 1576681..1576743 | + | 63 | NuclAT_19 | - | - |
| - (1576681) | 1576681..1576743 | + | 63 | NuclAT_19 | - | - |
| - (1576681) | 1576681..1576743 | + | 63 | NuclAT_19 | - | - |
| - (1576681) | 1576681..1576743 | + | 63 | NuclAT_19 | - | - |
| - (1576681) | 1576681..1576743 | + | 63 | NuclAT_20 | - | - |
| - (1576681) | 1576681..1576743 | + | 63 | NuclAT_20 | - | - |
| - (1576681) | 1576681..1576743 | + | 63 | NuclAT_20 | - | - |
| - (1576681) | 1576681..1576743 | + | 63 | NuclAT_20 | - | - |
| - (1576681) | 1576681..1576743 | + | 63 | NuclAT_22 | - | - |
| - (1576681) | 1576681..1576743 | + | 63 | NuclAT_22 | - | - |
| - (1576681) | 1576681..1576743 | + | 63 | NuclAT_22 | - | - |
| - (1576681) | 1576681..1576743 | + | 63 | NuclAT_22 | - | - |
| - (1576681) | 1576681..1576743 | + | 63 | NuclAT_23 | - | - |
| - (1576681) | 1576681..1576743 | + | 63 | NuclAT_23 | - | - |
| - (1576681) | 1576681..1576743 | + | 63 | NuclAT_23 | - | - |
| - (1576681) | 1576681..1576743 | + | 63 | NuclAT_23 | - | - |
| OO831_RS07570 (1577057) | 1577057..1577164 | - | 108 | WP_000170963.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - (1577212) | 1577212..1577271 | + | 60 | NuclAT_25 | - | Antitoxin |
| - (1577212) | 1577212..1577271 | + | 60 | NuclAT_25 | - | Antitoxin |
| - (1577212) | 1577212..1577271 | + | 60 | NuclAT_25 | - | Antitoxin |
| - (1577212) | 1577212..1577271 | + | 60 | NuclAT_25 | - | Antitoxin |
| - (1577212) | 1577212..1577271 | + | 60 | NuclAT_27 | - | Antitoxin |
| - (1577212) | 1577212..1577271 | + | 60 | NuclAT_27 | - | Antitoxin |
| - (1577212) | 1577212..1577271 | + | 60 | NuclAT_27 | - | Antitoxin |
| - (1577212) | 1577212..1577271 | + | 60 | NuclAT_27 | - | Antitoxin |
| - (1577212) | 1577212..1577271 | + | 60 | NuclAT_29 | - | Antitoxin |
| - (1577212) | 1577212..1577271 | + | 60 | NuclAT_29 | - | Antitoxin |
| - (1577212) | 1577212..1577271 | + | 60 | NuclAT_29 | - | Antitoxin |
| - (1577212) | 1577212..1577271 | + | 60 | NuclAT_29 | - | Antitoxin |
| - (1577212) | 1577212..1577271 | + | 60 | NuclAT_31 | - | Antitoxin |
| - (1577212) | 1577212..1577271 | + | 60 | NuclAT_31 | - | Antitoxin |
| - (1577212) | 1577212..1577271 | + | 60 | NuclAT_31 | - | Antitoxin |
| - (1577212) | 1577212..1577271 | + | 60 | NuclAT_31 | - | Antitoxin |
| - (1577212) | 1577212..1577271 | + | 60 | NuclAT_33 | - | Antitoxin |
| - (1577212) | 1577212..1577271 | + | 60 | NuclAT_33 | - | Antitoxin |
| - (1577212) | 1577212..1577271 | + | 60 | NuclAT_33 | - | Antitoxin |
| - (1577212) | 1577212..1577271 | + | 60 | NuclAT_33 | - | Antitoxin |
| OO831_RS07575 (1577563) | 1577563..1578663 | - | 1101 | WP_001301956.1 | sodium-potassium/proton antiporter ChaA | - |
| OO831_RS07580 (1578933) | 1578933..1579163 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
| OO831_RS07585 (1579324) | 1579324..1580019 | + | 696 | WP_001301489.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| OO831_RS07590 (1580063) | 1580063..1580416 | - | 354 | WP_001169661.1 | DsrE/F sulfur relay family protein YchN | - |
| OO831_RS07595 (1580602) | 1580602..1581996 | + | 1395 | WP_000086192.1 | inverse autotransporter invasin YchO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3971.74 Da Isoelectric Point: 11.4779
>T42203 WP_000170963.1 NZ_AP026106:c1577164-1577057 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T42203 NZ_AP026106:c1577164-1577057 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 60 bp
>AT42203 NZ_AP026106:1577212-1577271 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
GTCTGGTTTCAAGATTAGCCCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|