Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1577057..1577271 Replicon chromosome
Accession NZ_AP026106
Organism Escherichia coli strain CEC01311

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag OO831_RS07570 Protein ID WP_000170963.1
Coordinates 1577057..1577164 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1577212..1577271 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OO831_RS07540 (1572366) 1572366..1573448 + 1083 WP_000804726.1 peptide chain release factor 1 -
OO831_RS07545 (1573448) 1573448..1574281 + 834 WP_000456466.1 peptide chain release factor N(5)-glutamine methyltransferase -
OO831_RS07550 (1574278) 1574278..1574670 + 393 WP_000200379.1 invasion regulator SirB2 -
OO831_RS07555 (1574674) 1574674..1575483 + 810 WP_001257044.1 invasion regulator SirB1 -
OO831_RS07560 (1575519) 1575519..1576373 + 855 WP_000811067.1 3-deoxy-8-phosphooctulonate synthase -
OO831_RS07565 (1576521) 1576521..1576628 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1576681) 1576681..1576742 + 62 NuclAT_24 - -
- (1576681) 1576681..1576742 + 62 NuclAT_24 - -
- (1576681) 1576681..1576742 + 62 NuclAT_24 - -
- (1576681) 1576681..1576742 + 62 NuclAT_24 - -
- (1576681) 1576681..1576742 + 62 NuclAT_26 - -
- (1576681) 1576681..1576742 + 62 NuclAT_26 - -
- (1576681) 1576681..1576742 + 62 NuclAT_26 - -
- (1576681) 1576681..1576742 + 62 NuclAT_26 - -
- (1576681) 1576681..1576742 + 62 NuclAT_28 - -
- (1576681) 1576681..1576742 + 62 NuclAT_28 - -
- (1576681) 1576681..1576742 + 62 NuclAT_28 - -
- (1576681) 1576681..1576742 + 62 NuclAT_28 - -
- (1576681) 1576681..1576742 + 62 NuclAT_30 - -
- (1576681) 1576681..1576742 + 62 NuclAT_30 - -
- (1576681) 1576681..1576742 + 62 NuclAT_30 - -
- (1576681) 1576681..1576742 + 62 NuclAT_30 - -
- (1576681) 1576681..1576742 + 62 NuclAT_32 - -
- (1576681) 1576681..1576742 + 62 NuclAT_32 - -
- (1576681) 1576681..1576742 + 62 NuclAT_32 - -
- (1576681) 1576681..1576742 + 62 NuclAT_32 - -
- (1576681) 1576681..1576743 + 63 NuclAT_17 - -
- (1576681) 1576681..1576743 + 63 NuclAT_17 - -
- (1576681) 1576681..1576743 + 63 NuclAT_17 - -
- (1576681) 1576681..1576743 + 63 NuclAT_17 - -
- (1576681) 1576681..1576743 + 63 NuclAT_18 - -
- (1576681) 1576681..1576743 + 63 NuclAT_18 - -
- (1576681) 1576681..1576743 + 63 NuclAT_18 - -
- (1576681) 1576681..1576743 + 63 NuclAT_18 - -
- (1576681) 1576681..1576743 + 63 NuclAT_19 - -
- (1576681) 1576681..1576743 + 63 NuclAT_19 - -
- (1576681) 1576681..1576743 + 63 NuclAT_19 - -
- (1576681) 1576681..1576743 + 63 NuclAT_19 - -
- (1576681) 1576681..1576743 + 63 NuclAT_20 - -
- (1576681) 1576681..1576743 + 63 NuclAT_20 - -
- (1576681) 1576681..1576743 + 63 NuclAT_20 - -
- (1576681) 1576681..1576743 + 63 NuclAT_20 - -
- (1576681) 1576681..1576743 + 63 NuclAT_22 - -
- (1576681) 1576681..1576743 + 63 NuclAT_22 - -
- (1576681) 1576681..1576743 + 63 NuclAT_22 - -
- (1576681) 1576681..1576743 + 63 NuclAT_22 - -
- (1576681) 1576681..1576743 + 63 NuclAT_23 - -
- (1576681) 1576681..1576743 + 63 NuclAT_23 - -
- (1576681) 1576681..1576743 + 63 NuclAT_23 - -
- (1576681) 1576681..1576743 + 63 NuclAT_23 - -
OO831_RS07570 (1577057) 1577057..1577164 - 108 WP_000170963.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (1577212) 1577212..1577271 + 60 NuclAT_25 - Antitoxin
- (1577212) 1577212..1577271 + 60 NuclAT_25 - Antitoxin
- (1577212) 1577212..1577271 + 60 NuclAT_25 - Antitoxin
- (1577212) 1577212..1577271 + 60 NuclAT_25 - Antitoxin
- (1577212) 1577212..1577271 + 60 NuclAT_27 - Antitoxin
- (1577212) 1577212..1577271 + 60 NuclAT_27 - Antitoxin
- (1577212) 1577212..1577271 + 60 NuclAT_27 - Antitoxin
- (1577212) 1577212..1577271 + 60 NuclAT_27 - Antitoxin
- (1577212) 1577212..1577271 + 60 NuclAT_29 - Antitoxin
- (1577212) 1577212..1577271 + 60 NuclAT_29 - Antitoxin
- (1577212) 1577212..1577271 + 60 NuclAT_29 - Antitoxin
- (1577212) 1577212..1577271 + 60 NuclAT_29 - Antitoxin
- (1577212) 1577212..1577271 + 60 NuclAT_31 - Antitoxin
- (1577212) 1577212..1577271 + 60 NuclAT_31 - Antitoxin
- (1577212) 1577212..1577271 + 60 NuclAT_31 - Antitoxin
- (1577212) 1577212..1577271 + 60 NuclAT_31 - Antitoxin
- (1577212) 1577212..1577271 + 60 NuclAT_33 - Antitoxin
- (1577212) 1577212..1577271 + 60 NuclAT_33 - Antitoxin
- (1577212) 1577212..1577271 + 60 NuclAT_33 - Antitoxin
- (1577212) 1577212..1577271 + 60 NuclAT_33 - Antitoxin
OO831_RS07575 (1577563) 1577563..1578663 - 1101 WP_001301956.1 sodium-potassium/proton antiporter ChaA -
OO831_RS07580 (1578933) 1578933..1579163 + 231 WP_001146444.1 putative cation transport regulator ChaB -
OO831_RS07585 (1579324) 1579324..1580019 + 696 WP_001301489.1 glutathione-specific gamma-glutamylcyclotransferase -
OO831_RS07590 (1580063) 1580063..1580416 - 354 WP_001169661.1 DsrE/F sulfur relay family protein YchN -
OO831_RS07595 (1580602) 1580602..1581996 + 1395 WP_000086192.1 inverse autotransporter invasin YchO -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T42203 WP_000170963.1 NZ_AP026106:c1577164-1577057 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T42203 NZ_AP026106:c1577164-1577057 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 60 bp

>AT42203 NZ_AP026106:1577212-1577271 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure


Antitoxin

Download structure file

References