Detailed information of TA system TA042203

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-rdlD/Ldr(toxin)
• Location: 1577057..1577271
• Replicon: chromosome
• Accession: NZ_AP026106
• Organism: Escherichia coli strain CEC01311

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: J7R083
• Locus tag: OO831_RS07570
• Protein ID: WP_000170963.1
• Coordinates: 1577057..1577164 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	rdlD
Locus tag	-
Coordinates	1577212..1577271 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
OO831_RS07540 (1572366)	1572366..1573448	+	1083	WP_000804726.1	peptide chain release factor 1	-
OO831_RS07545 (1573448)	1573448..1574281	+	834	WP_000456466.1	peptide chain release factor N(5)-glutamine methyltransferase	-
OO831_RS07550 (1574278)	1574278..1574670	+	393	WP_000200379.1	invasion regulator SirB2	-
OO831_RS07555 (1574674)	1574674..1575483	+	810	WP_001257044.1	invasion regulator SirB1	-
OO831_RS07560 (1575519)	1575519..1576373	+	855	WP_000811067.1	3-deoxy-8-phosphooctulonate synthase	-
OO831_RS07565 (1576521)	1576521..1576628	-	108	WP_000170954.1	type I toxin-antitoxin system toxin Ldr family protein	-
- (1576681)	1576681..1576742	+	62	NuclAT_24	-	-
- (1576681)	1576681..1576742	+	62	NuclAT_24	-	-
- (1576681)	1576681..1576742	+	62	NuclAT_24	-	-
- (1576681)	1576681..1576742	+	62	NuclAT_24	-	-
- (1576681)	1576681..1576742	+	62	NuclAT_26	-	-
- (1576681)	1576681..1576742	+	62	NuclAT_26	-	-
- (1576681)	1576681..1576742	+	62	NuclAT_26	-	-
- (1576681)	1576681..1576742	+	62	NuclAT_26	-	-
- (1576681)	1576681..1576742	+	62	NuclAT_28	-	-
- (1576681)	1576681..1576742	+	62	NuclAT_28	-	-
- (1576681)	1576681..1576742	+	62	NuclAT_28	-	-
- (1576681)	1576681..1576742	+	62	NuclAT_28	-	-
- (1576681)	1576681..1576742	+	62	NuclAT_30	-	-
- (1576681)	1576681..1576742	+	62	NuclAT_30	-	-
- (1576681)	1576681..1576742	+	62	NuclAT_30	-	-
- (1576681)	1576681..1576742	+	62	NuclAT_30	-	-
- (1576681)	1576681..1576742	+	62	NuclAT_32	-	-
- (1576681)	1576681..1576742	+	62	NuclAT_32	-	-
- (1576681)	1576681..1576742	+	62	NuclAT_32	-	-
- (1576681)	1576681..1576742	+	62	NuclAT_32	-	-
- (1576681)	1576681..1576743	+	63	NuclAT_17	-	-
- (1576681)	1576681..1576743	+	63	NuclAT_17	-	-
- (1576681)	1576681..1576743	+	63	NuclAT_17	-	-
- (1576681)	1576681..1576743	+	63	NuclAT_17	-	-
- (1576681)	1576681..1576743	+	63	NuclAT_18	-	-
- (1576681)	1576681..1576743	+	63	NuclAT_18	-	-
- (1576681)	1576681..1576743	+	63	NuclAT_18	-	-
- (1576681)	1576681..1576743	+	63	NuclAT_18	-	-
- (1576681)	1576681..1576743	+	63	NuclAT_19	-	-
- (1576681)	1576681..1576743	+	63	NuclAT_19	-	-
- (1576681)	1576681..1576743	+	63	NuclAT_19	-	-
- (1576681)	1576681..1576743	+	63	NuclAT_19	-	-
- (1576681)	1576681..1576743	+	63	NuclAT_20	-	-
- (1576681)	1576681..1576743	+	63	NuclAT_20	-	-
- (1576681)	1576681..1576743	+	63	NuclAT_20	-	-
- (1576681)	1576681..1576743	+	63	NuclAT_20	-	-
- (1576681)	1576681..1576743	+	63	NuclAT_22	-	-
- (1576681)	1576681..1576743	+	63	NuclAT_22	-	-
- (1576681)	1576681..1576743	+	63	NuclAT_22	-	-
- (1576681)	1576681..1576743	+	63	NuclAT_22	-	-
- (1576681)	1576681..1576743	+	63	NuclAT_23	-	-
- (1576681)	1576681..1576743	+	63	NuclAT_23	-	-
- (1576681)	1576681..1576743	+	63	NuclAT_23	-	-
- (1576681)	1576681..1576743	+	63	NuclAT_23	-	-
OO831_RS07570 (1577057)	1577057..1577164	-	108	WP_000170963.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
- (1577212)	1577212..1577271	+	60	NuclAT_25	-	Antitoxin
- (1577212)	1577212..1577271	+	60	NuclAT_25	-	Antitoxin
- (1577212)	1577212..1577271	+	60	NuclAT_25	-	Antitoxin
- (1577212)	1577212..1577271	+	60	NuclAT_25	-	Antitoxin
- (1577212)	1577212..1577271	+	60	NuclAT_27	-	Antitoxin
- (1577212)	1577212..1577271	+	60	NuclAT_27	-	Antitoxin
- (1577212)	1577212..1577271	+	60	NuclAT_27	-	Antitoxin
- (1577212)	1577212..1577271	+	60	NuclAT_27	-	Antitoxin
- (1577212)	1577212..1577271	+	60	NuclAT_29	-	Antitoxin
- (1577212)	1577212..1577271	+	60	NuclAT_29	-	Antitoxin
- (1577212)	1577212..1577271	+	60	NuclAT_29	-	Antitoxin
- (1577212)	1577212..1577271	+	60	NuclAT_29	-	Antitoxin
- (1577212)	1577212..1577271	+	60	NuclAT_31	-	Antitoxin
- (1577212)	1577212..1577271	+	60	NuclAT_31	-	Antitoxin
- (1577212)	1577212..1577271	+	60	NuclAT_31	-	Antitoxin
- (1577212)	1577212..1577271	+	60	NuclAT_31	-	Antitoxin
- (1577212)	1577212..1577271	+	60	NuclAT_33	-	Antitoxin
- (1577212)	1577212..1577271	+	60	NuclAT_33	-	Antitoxin
- (1577212)	1577212..1577271	+	60	NuclAT_33	-	Antitoxin
- (1577212)	1577212..1577271	+	60	NuclAT_33	-	Antitoxin
OO831_RS07575 (1577563)	1577563..1578663	-	1101	WP_001301956.1	sodium-potassium/proton antiporter ChaA	-
OO831_RS07580 (1578933)	1578933..1579163	+	231	WP_001146444.1	putative cation transport regulator ChaB	-
OO831_RS07585 (1579324)	1579324..1580019	+	696	WP_001301489.1	glutathione-specific gamma-glutamylcyclotransferase	-
OO831_RS07590 (1580063)	1580063..1580416	-	354	WP_001169661.1	DsrE/F sulfur relay family protein YchN	-
OO831_RS07595 (1580602)	1580602..1581996	+	1395	WP_000086192.1	inverse autotransporter invasin YchO	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 3971.74 Da
• Isoelectric Point: 11.4779

>T42203 WP_000170963.1 NZ_AP026106:c1577164-1577057 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Nucleotide

• Length: 108 bp

>T42203 NZ_AP026106:c1577164-1577057 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin

Nucleotide

• Length: 60 bp

>AT42203 NZ_AP026106:1577212-1577271 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Structures

Antitoxin