Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 1248655..1248880 | Replicon | chromosome |
Accession | NZ_AP026106 | ||
Organism | Escherichia coli strain CEC01311 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | - |
Locus tag | OO831_RS05865 | Protein ID | WP_000813263.1 |
Coordinates | 1248725..1248880 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 1248655..1248713 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OO831_RS05835 | 1243930..1245021 | + | 1092 | WP_001205823.1 | hypothetical protein | - |
OO831_RS05840 | 1245028..1245774 | + | 747 | WP_000788745.1 | ATP-binding protein | - |
OO831_RS05845 | 1245796..1246566 | + | 771 | WP_000450992.1 | DUF1627 domain-containing protein | - |
OO831_RS05850 | 1246582..1246995 | + | 414 | WP_001151233.1 | DUF977 family protein | - |
OO831_RS05855 | 1247347..1248120 | - | 774 | WP_000160654.1 | alpha/beta hydrolase | - |
- | 1248655..1248713 | - | 59 | - | - | Antitoxin |
OO831_RS05865 | 1248725..1248880 | + | 156 | WP_000813263.1 | type I toxin-antitoxin system toxin HokD | Toxin |
OO831_RS05870 | 1249048..1249326 | + | 279 | WP_001341388.1 | hypothetical protein | - |
OO831_RS05875 | 1249328..1250377 | + | 1050 | WP_001265172.1 | DUF968 domain-containing protein | - |
OO831_RS05880 | 1250390..1250761 | + | 372 | WP_001217436.1 | RusA family crossover junction endodeoxyribonuclease | - |
OO831_RS05885 | 1250751..1251122 | + | 372 | WP_000090264.1 | antiterminator Q family protein | - |
OO831_RS05890 | 1251274..1252092 | + | 819 | WP_000265265.1 | CPBP family intramembrane metalloprotease | - |
OO831_RS05895 | 1252379..1252575 | + | 197 | Protein_1156 | TrmB family transcriptional regulator | - |
OO831_RS05900 | 1252713..1253426 | + | 714 | WP_000261909.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5722.86 Da Isoelectric Point: 6.1531
>T42201 WP_000813263.1 NZ_AP026106:1248725-1248880 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T42201 NZ_AP026106:1248725-1248880 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT42201 NZ_AP026106:c1248713-1248655 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|