Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-ohsC/Ldr(toxin) |
| Location | 4365624..4365845 | Replicon | chromosome |
| Accession | NZ_AP026104 | ||
| Organism | Escherichia coli strain CEC96047 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1NWX0 |
| Locus tag | OO843_RS21950 | Protein ID | WP_001295224.1 |
| Coordinates | 4365624..4365731 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | ohsC | ||
| Locus tag | - | ||
| Coordinates | 4365780..4365845 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OO843_RS21925 (4360877) | 4360877..4361629 | - | 753 | Protein_4295 | cellulose biosynthesis protein BcsQ | - |
| OO843_RS21930 (4361641) | 4361641..4361829 | - | 189 | WP_001063316.1 | cellulose biosynthesis protein BcsR | - |
| OO843_RS21935 (4362102) | 4362102..4363673 | + | 1572 | WP_001204920.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
| OO843_RS21940 (4363670) | 4363670..4363861 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| OO843_RS21945 (4363858) | 4363858..4365537 | + | 1680 | WP_000191596.1 | cellulose biosynthesis protein BcsG | - |
| OO843_RS21950 (4365624) | 4365624..4365731 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - (4365780) | 4365780..4365845 | + | 66 | NuclAT_16 | - | Antitoxin |
| - (4365780) | 4365780..4365845 | + | 66 | NuclAT_16 | - | Antitoxin |
| - (4365780) | 4365780..4365845 | + | 66 | NuclAT_16 | - | Antitoxin |
| - (4365780) | 4365780..4365845 | + | 66 | NuclAT_16 | - | Antitoxin |
| - (4365780) | 4365780..4365845 | + | 66 | NuclAT_21 | - | Antitoxin |
| - (4365780) | 4365780..4365845 | + | 66 | NuclAT_21 | - | Antitoxin |
| - (4365780) | 4365780..4365845 | + | 66 | NuclAT_21 | - | Antitoxin |
| - (4365780) | 4365780..4365845 | + | 66 | NuclAT_21 | - | Antitoxin |
| OO843_RS21955 (4366207) | 4366207..4367478 | + | 1272 | WP_001301684.1 | aromatic amino acid transport family protein | - |
| OO843_RS21960 (4367508) | 4367508..4368512 | - | 1005 | WP_000107027.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| OO843_RS21965 (4368509) | 4368509..4369492 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
| OO843_RS21970 (4369503) | 4369503..4370405 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T42186 WP_001295224.1 NZ_AP026104:c4365731-4365624 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T42186 NZ_AP026104:c4365731-4365624 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 66 bp
>AT42186 NZ_AP026104:4365780-4365845 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|