Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-ohsC/Ldr(toxin)
Location 4365624..4365845 Replicon chromosome
Accession NZ_AP026104
Organism Escherichia coli strain CEC96047

Toxin (Protein)


Gene name ldrD Uniprot ID S1NWX0
Locus tag OO843_RS21950 Protein ID WP_001295224.1
Coordinates 4365624..4365731 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name ohsC
Locus tag -
Coordinates 4365780..4365845 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OO843_RS21925 (4360877) 4360877..4361629 - 753 Protein_4295 cellulose biosynthesis protein BcsQ -
OO843_RS21930 (4361641) 4361641..4361829 - 189 WP_001063316.1 cellulose biosynthesis protein BcsR -
OO843_RS21935 (4362102) 4362102..4363673 + 1572 WP_001204920.1 cellulose biosynthesis c-di-GMP-binding protein BcsE -
OO843_RS21940 (4363670) 4363670..4363861 + 192 WP_000988308.1 cellulose biosynthesis protein BcsF -
OO843_RS21945 (4363858) 4363858..4365537 + 1680 WP_000191596.1 cellulose biosynthesis protein BcsG -
OO843_RS21950 (4365624) 4365624..4365731 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (4365780) 4365780..4365845 + 66 NuclAT_16 - Antitoxin
- (4365780) 4365780..4365845 + 66 NuclAT_16 - Antitoxin
- (4365780) 4365780..4365845 + 66 NuclAT_16 - Antitoxin
- (4365780) 4365780..4365845 + 66 NuclAT_16 - Antitoxin
- (4365780) 4365780..4365845 + 66 NuclAT_21 - Antitoxin
- (4365780) 4365780..4365845 + 66 NuclAT_21 - Antitoxin
- (4365780) 4365780..4365845 + 66 NuclAT_21 - Antitoxin
- (4365780) 4365780..4365845 + 66 NuclAT_21 - Antitoxin
OO843_RS21955 (4366207) 4366207..4367478 + 1272 WP_001301684.1 aromatic amino acid transport family protein -
OO843_RS21960 (4367508) 4367508..4368512 - 1005 WP_000107027.1 dipeptide ABC transporter ATP-binding subunit DppF -
OO843_RS21965 (4368509) 4368509..4369492 - 984 WP_001196486.1 dipeptide ABC transporter ATP-binding protein -
OO843_RS21970 (4369503) 4369503..4370405 - 903 WP_000084677.1 dipeptide ABC transporter permease DppC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3882.70 Da        Isoelectric Point: 9.0157

>T42186 WP_001295224.1 NZ_AP026104:c4365731-4365624 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK

Download         Length: 108 bp

>T42186 NZ_AP026104:c4365731-4365624 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA

Antitoxin


Download         Length: 66 bp

>AT42186 NZ_AP026104:4365780-4365845 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TSJ7

Antitoxin

Download structure file

References