Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-ohsC/Ldr(toxin)
Location 4485804..4486025 Replicon chromosome
Accession NZ_AP026101
Organism Escherichia coli strain 93_161312

Toxin (Protein)


Gene name ldrD Uniprot ID S1NWX0
Locus tag OO868_RS22755 Protein ID WP_001295224.1
Coordinates 4485804..4485911 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name ohsC
Locus tag -
Coordinates 4485960..4486025 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OO868_RS22730 (4481058) 4481058..4481810 - 753 Protein_4453 cellulose biosynthesis protein BcsQ -
OO868_RS22735 (4481822) 4481822..4482010 - 189 WP_001063316.1 cellulose biosynthesis protein BcsR -
OO868_RS22740 (4482282) 4482282..4483853 + 1572 WP_001204920.1 cellulose biosynthesis c-di-GMP-binding protein BcsE -
OO868_RS22745 (4483850) 4483850..4484041 + 192 WP_000988308.1 cellulose biosynthesis protein BcsF -
OO868_RS22750 (4484038) 4484038..4485717 + 1680 WP_000191596.1 cellulose biosynthesis protein BcsG -
OO868_RS22755 (4485804) 4485804..4485911 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (4485960) 4485960..4486025 + 66 NuclAT_16 - Antitoxin
- (4485960) 4485960..4486025 + 66 NuclAT_16 - Antitoxin
- (4485960) 4485960..4486025 + 66 NuclAT_16 - Antitoxin
- (4485960) 4485960..4486025 + 66 NuclAT_16 - Antitoxin
- (4485960) 4485960..4486025 + 66 NuclAT_21 - Antitoxin
- (4485960) 4485960..4486025 + 66 NuclAT_21 - Antitoxin
- (4485960) 4485960..4486025 + 66 NuclAT_21 - Antitoxin
- (4485960) 4485960..4486025 + 66 NuclAT_21 - Antitoxin
OO868_RS22760 (4486387) 4486387..4487658 + 1272 WP_001301684.1 aromatic amino acid transport family protein -
OO868_RS22765 (4487688) 4487688..4488692 - 1005 WP_000107027.1 dipeptide ABC transporter ATP-binding subunit DppF -
OO868_RS22770 (4488689) 4488689..4489672 - 984 WP_001196486.1 dipeptide ABC transporter ATP-binding protein -
OO868_RS22775 (4489683) 4489683..4490585 - 903 WP_000084677.1 dipeptide ABC transporter permease DppC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3882.70 Da        Isoelectric Point: 9.0157

>T42152 WP_001295224.1 NZ_AP026101:c4485911-4485804 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK

Download         Length: 108 bp

>T42152 NZ_AP026101:c4485911-4485804 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA

Antitoxin


Download         Length: 66 bp

>AT42152 NZ_AP026101:4485960-4486025 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TSJ7

Antitoxin

Download structure file

References