Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-ohsC/Ldr(toxin) |
| Location | 4485804..4486025 | Replicon | chromosome |
| Accession | NZ_AP026101 | ||
| Organism | Escherichia coli strain 93_161312 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1NWX0 |
| Locus tag | OO868_RS22755 | Protein ID | WP_001295224.1 |
| Coordinates | 4485804..4485911 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | ohsC | ||
| Locus tag | - | ||
| Coordinates | 4485960..4486025 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OO868_RS22730 (4481058) | 4481058..4481810 | - | 753 | Protein_4453 | cellulose biosynthesis protein BcsQ | - |
| OO868_RS22735 (4481822) | 4481822..4482010 | - | 189 | WP_001063316.1 | cellulose biosynthesis protein BcsR | - |
| OO868_RS22740 (4482282) | 4482282..4483853 | + | 1572 | WP_001204920.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
| OO868_RS22745 (4483850) | 4483850..4484041 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| OO868_RS22750 (4484038) | 4484038..4485717 | + | 1680 | WP_000191596.1 | cellulose biosynthesis protein BcsG | - |
| OO868_RS22755 (4485804) | 4485804..4485911 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - (4485960) | 4485960..4486025 | + | 66 | NuclAT_16 | - | Antitoxin |
| - (4485960) | 4485960..4486025 | + | 66 | NuclAT_16 | - | Antitoxin |
| - (4485960) | 4485960..4486025 | + | 66 | NuclAT_16 | - | Antitoxin |
| - (4485960) | 4485960..4486025 | + | 66 | NuclAT_16 | - | Antitoxin |
| - (4485960) | 4485960..4486025 | + | 66 | NuclAT_21 | - | Antitoxin |
| - (4485960) | 4485960..4486025 | + | 66 | NuclAT_21 | - | Antitoxin |
| - (4485960) | 4485960..4486025 | + | 66 | NuclAT_21 | - | Antitoxin |
| - (4485960) | 4485960..4486025 | + | 66 | NuclAT_21 | - | Antitoxin |
| OO868_RS22760 (4486387) | 4486387..4487658 | + | 1272 | WP_001301684.1 | aromatic amino acid transport family protein | - |
| OO868_RS22765 (4487688) | 4487688..4488692 | - | 1005 | WP_000107027.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| OO868_RS22770 (4488689) | 4488689..4489672 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
| OO868_RS22775 (4489683) | 4489683..4490585 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T42152 WP_001295224.1 NZ_AP026101:c4485911-4485804 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T42152 NZ_AP026101:c4485911-4485804 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 66 bp
>AT42152 NZ_AP026101:4485960-4486025 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
