Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 1703075..1703300 | Replicon | chromosome |
| Accession | NZ_AP026101 | ||
| Organism | Escherichia coli strain 93_161312 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
| Locus tag | OO868_RS08375 | Protein ID | WP_000813258.1 |
| Coordinates | 1703145..1703300 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 1703075..1703133 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OO868_RS08325 | 1698140..1698382 | + | 243 | WP_000747948.1 | Cro/CI family transcriptional regulator | - |
| OO868_RS08330 | 1698366..1698791 | + | 426 | WP_000693878.1 | toxin YdaT family protein | - |
| OO868_RS08335 | 1698860..1699903 | + | 1044 | WP_001262402.1 | DnaT-like ssDNA-binding domain-containing protein | - |
| OO868_RS08340 | 1699896..1700357 | + | 462 | WP_000139447.1 | replication protein P | - |
| OO868_RS08345 | 1700391..1701107 | + | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
| OO868_RS08350 | 1701140..1701421 | + | 282 | WP_000603384.1 | DNA-binding protein | - |
| OO868_RS08355 | 1701418..1701645 | + | 228 | WP_000699809.1 | hypothetical protein | - |
| OO868_RS08360 | 1701638..1701949 | + | 312 | WP_001289673.1 | hypothetical protein | - |
| OO868_RS08365 | 1702077..1702295 | + | 219 | WP_000683609.1 | DUF4014 family protein | - |
| OO868_RS08370 | 1702297..1702854 | + | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
| - | 1703075..1703133 | - | 59 | - | - | Antitoxin |
| OO868_RS08375 | 1703145..1703300 | + | 156 | WP_000813258.1 | Hok/Gef family protein | Toxin |
| OO868_RS08380 | 1703420..1703764 | + | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
| OO868_RS08385 | 1703886..1704158 | + | 273 | WP_000191870.1 | hypothetical protein | - |
| OO868_RS08390 | 1704160..1705209 | + | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
| OO868_RS08395 | 1705222..1705527 | + | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
| OO868_RS08400 | 1705590..1706144 | + | 555 | WP_000640035.1 | DUF1133 family protein | - |
| OO868_RS08405 | 1706369..1706566 | + | 198 | WP_000917763.1 | hypothetical protein | - |
| OO868_RS08410 | 1706702..1707415 | + | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
| OO868_RS08425 | 1707870..1708298 | + | 429 | WP_001303509.1 | tellurite resistance protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | nleG7' | 1641096..1740758 | 99662 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T42141 WP_000813258.1 NZ_AP026101:1703145-1703300 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
>T42141 NZ_AP026101:1703145-1703300 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
Antitoxin
Download Length: 59 bp
>AT42141 NZ_AP026101:c1703133-1703075 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|