Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-ohsC/Ldr(toxin)
Location 4442032..4442253 Replicon chromosome
Accession NZ_AP026097
Organism Escherichia coli strain 57_142493

Toxin (Protein)


Gene name ldrD Uniprot ID S1NWX0
Locus tag OO832_RS22470 Protein ID WP_001295224.1
Coordinates 4442032..4442139 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name ohsC
Locus tag -
Coordinates 4442188..4442253 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OO832_RS22445 (4437285) 4437285..4438037 - 753 Protein_4397 cellulose biosynthesis protein BcsQ -
OO832_RS22450 (4438049) 4438049..4438237 - 189 WP_001063316.1 cellulose biosynthesis protein BcsR -
OO832_RS22455 (4438510) 4438510..4440081 + 1572 WP_001204920.1 cellulose biosynthesis c-di-GMP-binding protein BcsE -
OO832_RS22460 (4440078) 4440078..4440269 + 192 WP_000988308.1 cellulose biosynthesis protein BcsF -
OO832_RS22465 (4440266) 4440266..4441945 + 1680 WP_000191596.1 cellulose biosynthesis protein BcsG -
OO832_RS22470 (4442032) 4442032..4442139 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (4442188) 4442188..4442253 + 66 NuclAT_16 - Antitoxin
- (4442188) 4442188..4442253 + 66 NuclAT_16 - Antitoxin
- (4442188) 4442188..4442253 + 66 NuclAT_16 - Antitoxin
- (4442188) 4442188..4442253 + 66 NuclAT_16 - Antitoxin
- (4442188) 4442188..4442253 + 66 NuclAT_21 - Antitoxin
- (4442188) 4442188..4442253 + 66 NuclAT_21 - Antitoxin
- (4442188) 4442188..4442253 + 66 NuclAT_21 - Antitoxin
- (4442188) 4442188..4442253 + 66 NuclAT_21 - Antitoxin
OO832_RS22475 (4442615) 4442615..4443886 + 1272 WP_001301684.1 aromatic amino acid transport family protein -
OO832_RS22480 (4443916) 4443916..4444920 - 1005 WP_000107027.1 dipeptide ABC transporter ATP-binding subunit DppF -
OO832_RS22485 (4444917) 4444917..4445900 - 984 WP_001196486.1 dipeptide ABC transporter ATP-binding protein -
OO832_RS22490 (4445911) 4445911..4446813 - 903 WP_000084677.1 dipeptide ABC transporter permease DppC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3882.70 Da        Isoelectric Point: 9.0157

>T42086 WP_001295224.1 NZ_AP026097:c4442139-4442032 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK

Download         Length: 108 bp

>T42086 NZ_AP026097:c4442139-4442032 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA

Antitoxin


Download         Length: 66 bp

>AT42086 NZ_AP026097:4442188-4442253 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TSJ7

Antitoxin

Download structure file

References