Detailed information of TA system TA042067

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-rdlD/Ldr(toxin)
• Location: 1605307..1605521
• Replicon: chromosome
• Accession: NZ_AP026097
• Organism: Escherichia coli strain 57_142493

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: J7R083
• Locus tag: OO832_RS07755
• Protein ID: WP_000170963.1
• Coordinates: 1605307..1605414 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	rdlD
Locus tag	-
Coordinates	1605462..1605521 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
OO832_RS07725 (1600622)	1600622..1601704	+	1083	WP_000804726.1	peptide chain release factor 1	-
OO832_RS07730 (1601704)	1601704..1602531	+	828	WP_264831054.1	peptide chain release factor N(5)-glutamine methyltransferase	-
OO832_RS07735 (1602528)	1602528..1602920	+	393	WP_000200379.1	invasion regulator SirB2	-
OO832_RS07740 (1602924)	1602924..1603733	+	810	WP_001257044.1	invasion regulator SirB1	-
OO832_RS07745 (1603769)	1603769..1604623	+	855	WP_000811067.1	3-deoxy-8-phosphooctulonate synthase	-
OO832_RS07750 (1604771)	1604771..1604878	-	108	WP_000170954.1	type I toxin-antitoxin system toxin Ldr family protein	-
- (1604931)	1604931..1604992	+	62	NuclAT_24	-	-
- (1604931)	1604931..1604992	+	62	NuclAT_24	-	-
- (1604931)	1604931..1604992	+	62	NuclAT_24	-	-
- (1604931)	1604931..1604992	+	62	NuclAT_24	-	-
- (1604931)	1604931..1604992	+	62	NuclAT_26	-	-
- (1604931)	1604931..1604992	+	62	NuclAT_26	-	-
- (1604931)	1604931..1604992	+	62	NuclAT_26	-	-
- (1604931)	1604931..1604992	+	62	NuclAT_26	-	-
- (1604931)	1604931..1604992	+	62	NuclAT_28	-	-
- (1604931)	1604931..1604992	+	62	NuclAT_28	-	-
- (1604931)	1604931..1604992	+	62	NuclAT_28	-	-
- (1604931)	1604931..1604992	+	62	NuclAT_28	-	-
- (1604931)	1604931..1604992	+	62	NuclAT_30	-	-
- (1604931)	1604931..1604992	+	62	NuclAT_30	-	-
- (1604931)	1604931..1604992	+	62	NuclAT_30	-	-
- (1604931)	1604931..1604992	+	62	NuclAT_30	-	-
- (1604931)	1604931..1604992	+	62	NuclAT_32	-	-
- (1604931)	1604931..1604992	+	62	NuclAT_32	-	-
- (1604931)	1604931..1604992	+	62	NuclAT_32	-	-
- (1604931)	1604931..1604992	+	62	NuclAT_32	-	-
- (1604931)	1604931..1604993	+	63	NuclAT_17	-	-
- (1604931)	1604931..1604993	+	63	NuclAT_17	-	-
- (1604931)	1604931..1604993	+	63	NuclAT_17	-	-
- (1604931)	1604931..1604993	+	63	NuclAT_17	-	-
- (1604931)	1604931..1604993	+	63	NuclAT_18	-	-
- (1604931)	1604931..1604993	+	63	NuclAT_18	-	-
- (1604931)	1604931..1604993	+	63	NuclAT_18	-	-
- (1604931)	1604931..1604993	+	63	NuclAT_18	-	-
- (1604931)	1604931..1604993	+	63	NuclAT_19	-	-
- (1604931)	1604931..1604993	+	63	NuclAT_19	-	-
- (1604931)	1604931..1604993	+	63	NuclAT_19	-	-
- (1604931)	1604931..1604993	+	63	NuclAT_19	-	-
- (1604931)	1604931..1604993	+	63	NuclAT_20	-	-
- (1604931)	1604931..1604993	+	63	NuclAT_20	-	-
- (1604931)	1604931..1604993	+	63	NuclAT_20	-	-
- (1604931)	1604931..1604993	+	63	NuclAT_20	-	-
- (1604931)	1604931..1604993	+	63	NuclAT_22	-	-
- (1604931)	1604931..1604993	+	63	NuclAT_22	-	-
- (1604931)	1604931..1604993	+	63	NuclAT_22	-	-
- (1604931)	1604931..1604993	+	63	NuclAT_22	-	-
- (1604931)	1604931..1604993	+	63	NuclAT_23	-	-
- (1604931)	1604931..1604993	+	63	NuclAT_23	-	-
- (1604931)	1604931..1604993	+	63	NuclAT_23	-	-
- (1604931)	1604931..1604993	+	63	NuclAT_23	-	-
OO832_RS07755 (1605307)	1605307..1605414	-	108	WP_000170963.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
- (1605462)	1605462..1605521	+	60	NuclAT_25	-	Antitoxin
- (1605462)	1605462..1605521	+	60	NuclAT_25	-	Antitoxin
- (1605462)	1605462..1605521	+	60	NuclAT_25	-	Antitoxin
- (1605462)	1605462..1605521	+	60	NuclAT_25	-	Antitoxin
- (1605462)	1605462..1605521	+	60	NuclAT_27	-	Antitoxin
- (1605462)	1605462..1605521	+	60	NuclAT_27	-	Antitoxin
- (1605462)	1605462..1605521	+	60	NuclAT_27	-	Antitoxin
- (1605462)	1605462..1605521	+	60	NuclAT_27	-	Antitoxin
- (1605462)	1605462..1605521	+	60	NuclAT_29	-	Antitoxin
- (1605462)	1605462..1605521	+	60	NuclAT_29	-	Antitoxin
- (1605462)	1605462..1605521	+	60	NuclAT_29	-	Antitoxin
- (1605462)	1605462..1605521	+	60	NuclAT_29	-	Antitoxin
- (1605462)	1605462..1605521	+	60	NuclAT_31	-	Antitoxin
- (1605462)	1605462..1605521	+	60	NuclAT_31	-	Antitoxin
- (1605462)	1605462..1605521	+	60	NuclAT_31	-	Antitoxin
- (1605462)	1605462..1605521	+	60	NuclAT_31	-	Antitoxin
- (1605462)	1605462..1605521	+	60	NuclAT_33	-	Antitoxin
- (1605462)	1605462..1605521	+	60	NuclAT_33	-	Antitoxin
- (1605462)	1605462..1605521	+	60	NuclAT_33	-	Antitoxin
- (1605462)	1605462..1605521	+	60	NuclAT_33	-	Antitoxin
OO832_RS07760 (1605813)	1605813..1606913	-	1101	WP_001301956.1	sodium-potassium/proton antiporter ChaA	-
OO832_RS07765 (1607183)	1607183..1607413	+	231	WP_001146444.1	putative cation transport regulator ChaB	-
OO832_RS07770 (1607574)	1607574..1608269	+	696	WP_001301489.1	glutathione-specific gamma-glutamylcyclotransferase	-
OO832_RS07775 (1608313)	1608313..1608666	-	354	WP_001169661.1	DsrE/F sulfur relay family protein YchN	-
OO832_RS07780 (1608852)	1608852..1610246	+	1395	WP_000086192.1	inverse autotransporter invasin YchO	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 3971.74 Da
• Isoelectric Point: 11.4779

>T42067 WP_000170963.1 NZ_AP026097:c1605414-1605307 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Nucleotide

• Length: 108 bp

>T42067 NZ_AP026097:c1605414-1605307 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin

Nucleotide

• Length: 60 bp

>AT42067 NZ_AP026097:1605462-1605521 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Structures

Antitoxin