Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-ohsC/Ldr(toxin) |
Location | 4343640..4343861 | Replicon | chromosome |
Accession | NZ_AP026095 | ||
Organism | Escherichia coli strain 53_142304 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1NWX0 |
Locus tag | OO816_RS21815 | Protein ID | WP_001295224.1 |
Coordinates | 4343640..4343747 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | ohsC | ||
Locus tag | - | ||
Coordinates | 4343796..4343861 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OO816_RS21790 (4338893) | 4338893..4339645 | - | 753 | Protein_4267 | cellulose biosynthesis protein BcsQ | - |
OO816_RS21795 (4339657) | 4339657..4339845 | - | 189 | WP_001063316.1 | cellulose biosynthesis protein BcsR | - |
OO816_RS21800 (4340118) | 4340118..4341689 | + | 1572 | WP_001204920.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
OO816_RS21805 (4341686) | 4341686..4341877 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
OO816_RS21810 (4341874) | 4341874..4343553 | + | 1680 | WP_000191596.1 | cellulose biosynthesis protein BcsG | - |
OO816_RS21815 (4343640) | 4343640..4343747 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- (4343796) | 4343796..4343861 | + | 66 | NuclAT_16 | - | Antitoxin |
- (4343796) | 4343796..4343861 | + | 66 | NuclAT_16 | - | Antitoxin |
- (4343796) | 4343796..4343861 | + | 66 | NuclAT_16 | - | Antitoxin |
- (4343796) | 4343796..4343861 | + | 66 | NuclAT_16 | - | Antitoxin |
- (4343796) | 4343796..4343861 | + | 66 | NuclAT_21 | - | Antitoxin |
- (4343796) | 4343796..4343861 | + | 66 | NuclAT_21 | - | Antitoxin |
- (4343796) | 4343796..4343861 | + | 66 | NuclAT_21 | - | Antitoxin |
- (4343796) | 4343796..4343861 | + | 66 | NuclAT_21 | - | Antitoxin |
OO816_RS21820 (4344223) | 4344223..4345494 | + | 1272 | WP_001301684.1 | aromatic amino acid transport family protein | - |
OO816_RS21825 (4345524) | 4345524..4346528 | - | 1005 | WP_000107027.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
OO816_RS21830 (4346525) | 4346525..4347508 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
OO816_RS21835 (4347519) | 4347519..4348421 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T42051 WP_001295224.1 NZ_AP026095:c4343747-4343640 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T42051 NZ_AP026095:c4343747-4343640 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 66 bp
>AT42051 NZ_AP026095:4343796-4343861 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|