Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-ohsC/Ldr(toxin)
Location 4343640..4343861 Replicon chromosome
Accession NZ_AP026095
Organism Escherichia coli strain 53_142304

Toxin (Protein)


Gene name ldrD Uniprot ID S1NWX0
Locus tag OO816_RS21815 Protein ID WP_001295224.1
Coordinates 4343640..4343747 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name ohsC
Locus tag -
Coordinates 4343796..4343861 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OO816_RS21790 (4338893) 4338893..4339645 - 753 Protein_4267 cellulose biosynthesis protein BcsQ -
OO816_RS21795 (4339657) 4339657..4339845 - 189 WP_001063316.1 cellulose biosynthesis protein BcsR -
OO816_RS21800 (4340118) 4340118..4341689 + 1572 WP_001204920.1 cellulose biosynthesis c-di-GMP-binding protein BcsE -
OO816_RS21805 (4341686) 4341686..4341877 + 192 WP_000988308.1 cellulose biosynthesis protein BcsF -
OO816_RS21810 (4341874) 4341874..4343553 + 1680 WP_000191596.1 cellulose biosynthesis protein BcsG -
OO816_RS21815 (4343640) 4343640..4343747 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (4343796) 4343796..4343861 + 66 NuclAT_16 - Antitoxin
- (4343796) 4343796..4343861 + 66 NuclAT_16 - Antitoxin
- (4343796) 4343796..4343861 + 66 NuclAT_16 - Antitoxin
- (4343796) 4343796..4343861 + 66 NuclAT_16 - Antitoxin
- (4343796) 4343796..4343861 + 66 NuclAT_21 - Antitoxin
- (4343796) 4343796..4343861 + 66 NuclAT_21 - Antitoxin
- (4343796) 4343796..4343861 + 66 NuclAT_21 - Antitoxin
- (4343796) 4343796..4343861 + 66 NuclAT_21 - Antitoxin
OO816_RS21820 (4344223) 4344223..4345494 + 1272 WP_001301684.1 aromatic amino acid transport family protein -
OO816_RS21825 (4345524) 4345524..4346528 - 1005 WP_000107027.1 dipeptide ABC transporter ATP-binding subunit DppF -
OO816_RS21830 (4346525) 4346525..4347508 - 984 WP_001196486.1 dipeptide ABC transporter ATP-binding protein -
OO816_RS21835 (4347519) 4347519..4348421 - 903 WP_000084677.1 dipeptide ABC transporter permease DppC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3882.70 Da        Isoelectric Point: 9.0157

>T42051 WP_001295224.1 NZ_AP026095:c4343747-4343640 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK

Download         Length: 108 bp

>T42051 NZ_AP026095:c4343747-4343640 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA

Antitoxin


Download         Length: 66 bp

>AT42051 NZ_AP026095:4343796-4343861 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TSJ7

Antitoxin

Download structure file

References