Detailed information of TA system TA042025

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 24174..24443
• Replicon: plasmid pNIID27_2
• Accession: NZ_AP026094
• Organism: Escherichia coli strain 27_141091

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: OO959_RS27585
• Protein ID: WP_001372321.1
• Coordinates: 24318..24443 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	24174..24239 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
OO959_RS27540 (19237)	19237..19470	+	234	WP_071588969.1	hypothetical protein	-
OO959_RS27545 (19711)	19711..19917	+	207	WP_000547968.1	hypothetical protein	-
OO959_RS27550 (19943)	19943..20482	+	540	WP_009426937.1	single-stranded DNA-binding protein	-
OO959_RS27555 (20544)	20544..20777	+	234	WP_000006030.1	DUF905 family protein	-
OO959_RS27560 (20842)	20842..22800	+	1959	WP_001530506.1	ParB/RepB/Spo0J family partition protein	-
OO959_RS27565 (22855)	22855..23289	+	435	WP_000845923.1	conjugation system SOS inhibitor PsiB	-
OO959_RS27570 (23286)	23286..24048	+	763	Protein_36	plasmid SOS inhibition protein A	-
OO959_RS27575 (24017)	24017..24205	-	189	WP_001336239.1	hypothetical protein	-
- (24174)	24174..24239	+	66	NuclAT_1	-	Antitoxin
- (24017)	24017..24241	+	225	NuclAT_0	-	-
- (24017)	24017..24241	+	225	NuclAT_0	-	-
- (24017)	24017..24241	+	225	NuclAT_0	-	-
- (24017)	24017..24241	+	225	NuclAT_0	-	-
- (24017)	24017..24241	-	225	NuclAT_0	-	-
OO959_RS27580 (24227)	24227..24376	+	150	Protein_38	plasmid maintenance protein Mok	-
OO959_RS27585 (24318)	24318..24443	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
OO959_RS27590 (24663)	24663..24893	+	231	WP_001426396.1	hypothetical protein	-
OO959_RS27595 (24891)	24891..25063	-	173	Protein_41	hypothetical protein	-
OO959_RS27600 (25133)	25133..25339	+	207	WP_050437515.1	hypothetical protein	-
OO959_RS27605 (25364)	25364..25651	+	288	WP_000107535.1	hypothetical protein	-
OO959_RS27610 (25771)	25771..26592	+	822	WP_264832301.1	DUF932 domain-containing protein	-
OO959_RS27615 (26889)	26889..27479	-	591	WP_165850686.1	transglycosylase SLT domain-containing protein	-
OO959_RS27620 (27812)	27812..28195	+	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
OO959_RS27625 (28382)	28382..29071	+	690	WP_000283380.1	conjugal transfer transcriptional regulator TraJ	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	-	-	1..66944	66944

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T42025 WP_001372321.1 NZ_AP026094:24318-24443 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

>T42025 NZ_AP026094:24318-24443 [Escherichia coli]
GTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACGAAAATCGCTGTGCGAGATTCGTTACAGAGACGG
ACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG

Antitoxin

Nucleotide

• Length: 66 bp

>AT42025 NZ_AP026094:24174-24239 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC

Structures

Antitoxin