Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-agrB/Ldr(toxin)
Location 4381480..4381701 Replicon chromosome
Accession NZ_AP026092
Organism Escherichia coli strain 27_141091

Toxin (Protein)


Gene name ldrD Uniprot ID S1NWX0
Locus tag OO959_RS21985 Protein ID WP_001295224.1
Coordinates 4381480..4381587 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name agrB
Locus tag -
Coordinates 4381636..4381701 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OO959_RS21960 (4376733) 4376733..4377485 - 753 Protein_4303 cellulose biosynthesis protein BcsQ -
OO959_RS21965 (4377497) 4377497..4377685 - 189 WP_001063316.1 cellulose biosynthesis protein BcsR -
OO959_RS21970 (4377958) 4377958..4379529 + 1572 WP_001204920.1 cellulose biosynthesis c-di-GMP-binding protein BcsE -
OO959_RS21975 (4379526) 4379526..4379717 + 192 WP_000988308.1 cellulose biosynthesis protein BcsF -
OO959_RS21980 (4379714) 4379714..4381393 + 1680 WP_000191596.1 cellulose biosynthesis protein BcsG -
OO959_RS21985 (4381480) 4381480..4381587 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (4381636) 4381636..4381701 + 66 NuclAT_17 - Antitoxin
- (4381636) 4381636..4381701 + 66 NuclAT_17 - Antitoxin
- (4381636) 4381636..4381701 + 66 NuclAT_17 - Antitoxin
- (4381636) 4381636..4381701 + 66 NuclAT_17 - Antitoxin
- (4381636) 4381636..4381701 + 66 NuclAT_22 - Antitoxin
- (4381636) 4381636..4381701 + 66 NuclAT_22 - Antitoxin
- (4381636) 4381636..4381701 + 66 NuclAT_22 - Antitoxin
- (4381636) 4381636..4381701 + 66 NuclAT_22 - Antitoxin
OO959_RS21990 (4382063) 4382063..4383334 + 1272 WP_001301684.1 aromatic amino acid transport family protein -
OO959_RS21995 (4383364) 4383364..4384368 - 1005 WP_000107027.1 dipeptide ABC transporter ATP-binding subunit DppF -
OO959_RS22000 (4384365) 4384365..4385348 - 984 WP_001196486.1 dipeptide ABC transporter ATP-binding protein -
OO959_RS22005 (4385359) 4385359..4386261 - 903 WP_000084677.1 dipeptide ABC transporter permease DppC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3882.70 Da        Isoelectric Point: 9.0157

>T42014 WP_001295224.1 NZ_AP026092:c4381587-4381480 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK

Download         Length: 108 bp

>T42014 NZ_AP026092:c4381587-4381480 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA

Antitoxin


Download         Length: 66 bp

>AT42014 NZ_AP026092:4381636-4381701 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TSJ7

Antitoxin

Download structure file

References