Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2052884..2053109 | Replicon | chromosome |
| Accession | NZ_AP026090 | ||
| Organism | Escherichia coli strain 26_141088 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
| Locus tag | OO788_RS10155 | Protein ID | WP_000813258.1 |
| Coordinates | 2052884..2053039 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 2053051..2053109 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OO788_RS10105 | 2047887..2048318 | - | 432 | WP_001302123.1 | tellurite resistance protein | - |
| OO788_RS10120 | 2048769..2049482 | - | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
| OO788_RS10125 | 2049618..2049815 | - | 198 | WP_000917763.1 | hypothetical protein | - |
| OO788_RS10130 | 2050040..2050594 | - | 555 | WP_000640035.1 | DUF1133 family protein | - |
| OO788_RS10135 | 2050657..2050962 | - | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
| OO788_RS10140 | 2050975..2052024 | - | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
| OO788_RS10145 | 2052026..2052298 | - | 273 | WP_000191872.1 | hypothetical protein | - |
| OO788_RS10150 | 2052420..2052764 | - | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
| OO788_RS10155 | 2052884..2053039 | - | 156 | WP_000813258.1 | Hok/Gef family protein | Toxin |
| - | 2053051..2053109 | + | 59 | - | - | Antitoxin |
| OO788_RS10160 | 2053330..2053887 | - | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
| OO788_RS10165 | 2053889..2054107 | - | 219 | WP_000683609.1 | DUF4014 family protein | - |
| OO788_RS10170 | 2054235..2054546 | - | 312 | WP_001289673.1 | hypothetical protein | - |
| OO788_RS10175 | 2054539..2054766 | - | 228 | WP_000699809.1 | hypothetical protein | - |
| OO788_RS10180 | 2054763..2055044 | - | 282 | WP_000603384.1 | DNA-binding protein | - |
| OO788_RS10185 | 2055077..2055793 | - | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
| OO788_RS10190 | 2055827..2056288 | - | 462 | WP_000139447.1 | replication protein P | - |
| OO788_RS10195 | 2056281..2057324 | - | 1044 | WP_001262402.1 | DnaT-like ssDNA-binding domain-containing protein | - |
| OO788_RS10200 | 2057393..2057818 | - | 426 | WP_000693878.1 | toxin YdaT family protein | - |
| OO788_RS10205 | 2057802..2058044 | - | 243 | WP_000747948.1 | Cro/CI family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | nleG7' | 2022429..2124123 | 101694 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T41960 WP_000813258.1 NZ_AP026090:c2053039-2052884 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
>T41960 NZ_AP026090:c2053039-2052884 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
Antitoxin
Download Length: 59 bp
>AT41960 NZ_AP026090:2053051-2053109 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|