Detailed information of TA system TA041957

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-rdlD/Ldr(toxin)
• Location: 1633432..1633646
• Replicon: chromosome
• Accession: NZ_AP026090
• Organism: Escherichia coli strain 26_141088

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: J7R083
• Locus tag: OO788_RS08025
• Protein ID: WP_000170963.1
• Coordinates: 1633432..1633539 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	rdlD
Locus tag	-
Coordinates	1633587..1633646 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
OO788_RS07995 (1628741)	1628741..1629823	+	1083	WP_000804726.1	peptide chain release factor 1	-
OO788_RS08000 (1629823)	1629823..1630656	+	834	WP_000456466.1	peptide chain release factor N(5)-glutamine methyltransferase	-
OO788_RS08005 (1630653)	1630653..1631045	+	393	WP_000200379.1	invasion regulator SirB2	-
OO788_RS08010 (1631049)	1631049..1631858	+	810	WP_001257044.1	invasion regulator SirB1	-
OO788_RS08015 (1631894)	1631894..1632748	+	855	WP_000811067.1	3-deoxy-8-phosphooctulonate synthase	-
OO788_RS08020 (1632896)	1632896..1633003	-	108	WP_000170954.1	type I toxin-antitoxin system toxin Ldr family protein	-
- (1633056)	1633056..1633117	+	62	NuclAT_24	-	-
- (1633056)	1633056..1633117	+	62	NuclAT_24	-	-
- (1633056)	1633056..1633117	+	62	NuclAT_24	-	-
- (1633056)	1633056..1633117	+	62	NuclAT_24	-	-
- (1633056)	1633056..1633117	+	62	NuclAT_26	-	-
- (1633056)	1633056..1633117	+	62	NuclAT_26	-	-
- (1633056)	1633056..1633117	+	62	NuclAT_26	-	-
- (1633056)	1633056..1633117	+	62	NuclAT_26	-	-
- (1633056)	1633056..1633117	+	62	NuclAT_28	-	-
- (1633056)	1633056..1633117	+	62	NuclAT_28	-	-
- (1633056)	1633056..1633117	+	62	NuclAT_28	-	-
- (1633056)	1633056..1633117	+	62	NuclAT_28	-	-
- (1633056)	1633056..1633117	+	62	NuclAT_30	-	-
- (1633056)	1633056..1633117	+	62	NuclAT_30	-	-
- (1633056)	1633056..1633117	+	62	NuclAT_30	-	-
- (1633056)	1633056..1633117	+	62	NuclAT_30	-	-
- (1633056)	1633056..1633117	+	62	NuclAT_32	-	-
- (1633056)	1633056..1633117	+	62	NuclAT_32	-	-
- (1633056)	1633056..1633117	+	62	NuclAT_32	-	-
- (1633056)	1633056..1633117	+	62	NuclAT_32	-	-
- (1633056)	1633056..1633118	+	63	NuclAT_17	-	-
- (1633056)	1633056..1633118	+	63	NuclAT_17	-	-
- (1633056)	1633056..1633118	+	63	NuclAT_17	-	-
- (1633056)	1633056..1633118	+	63	NuclAT_17	-	-
- (1633056)	1633056..1633118	+	63	NuclAT_18	-	-
- (1633056)	1633056..1633118	+	63	NuclAT_18	-	-
- (1633056)	1633056..1633118	+	63	NuclAT_18	-	-
- (1633056)	1633056..1633118	+	63	NuclAT_18	-	-
- (1633056)	1633056..1633118	+	63	NuclAT_19	-	-
- (1633056)	1633056..1633118	+	63	NuclAT_19	-	-
- (1633056)	1633056..1633118	+	63	NuclAT_19	-	-
- (1633056)	1633056..1633118	+	63	NuclAT_19	-	-
- (1633056)	1633056..1633118	+	63	NuclAT_20	-	-
- (1633056)	1633056..1633118	+	63	NuclAT_20	-	-
- (1633056)	1633056..1633118	+	63	NuclAT_20	-	-
- (1633056)	1633056..1633118	+	63	NuclAT_20	-	-
- (1633056)	1633056..1633118	+	63	NuclAT_22	-	-
- (1633056)	1633056..1633118	+	63	NuclAT_22	-	-
- (1633056)	1633056..1633118	+	63	NuclAT_22	-	-
- (1633056)	1633056..1633118	+	63	NuclAT_22	-	-
- (1633056)	1633056..1633118	+	63	NuclAT_23	-	-
- (1633056)	1633056..1633118	+	63	NuclAT_23	-	-
- (1633056)	1633056..1633118	+	63	NuclAT_23	-	-
- (1633056)	1633056..1633118	+	63	NuclAT_23	-	-
OO788_RS08025 (1633432)	1633432..1633539	-	108	WP_000170963.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
- (1633587)	1633587..1633646	+	60	NuclAT_25	-	Antitoxin
- (1633587)	1633587..1633646	+	60	NuclAT_25	-	Antitoxin
- (1633587)	1633587..1633646	+	60	NuclAT_25	-	Antitoxin
- (1633587)	1633587..1633646	+	60	NuclAT_25	-	Antitoxin
- (1633587)	1633587..1633646	+	60	NuclAT_27	-	Antitoxin
- (1633587)	1633587..1633646	+	60	NuclAT_27	-	Antitoxin
- (1633587)	1633587..1633646	+	60	NuclAT_27	-	Antitoxin
- (1633587)	1633587..1633646	+	60	NuclAT_27	-	Antitoxin
- (1633587)	1633587..1633646	+	60	NuclAT_29	-	Antitoxin
- (1633587)	1633587..1633646	+	60	NuclAT_29	-	Antitoxin
- (1633587)	1633587..1633646	+	60	NuclAT_29	-	Antitoxin
- (1633587)	1633587..1633646	+	60	NuclAT_29	-	Antitoxin
- (1633587)	1633587..1633646	+	60	NuclAT_31	-	Antitoxin
- (1633587)	1633587..1633646	+	60	NuclAT_31	-	Antitoxin
- (1633587)	1633587..1633646	+	60	NuclAT_31	-	Antitoxin
- (1633587)	1633587..1633646	+	60	NuclAT_31	-	Antitoxin
- (1633587)	1633587..1633646	+	60	NuclAT_33	-	Antitoxin
- (1633587)	1633587..1633646	+	60	NuclAT_33	-	Antitoxin
- (1633587)	1633587..1633646	+	60	NuclAT_33	-	Antitoxin
- (1633587)	1633587..1633646	+	60	NuclAT_33	-	Antitoxin
OO788_RS08030 (1633938)	1633938..1635038	-	1101	WP_001301956.1	sodium-potassium/proton antiporter ChaA	-
OO788_RS08035 (1635308)	1635308..1635538	+	231	WP_001146444.1	putative cation transport regulator ChaB	-
OO788_RS08040 (1635699)	1635699..1636394	+	696	WP_001301489.1	glutathione-specific gamma-glutamylcyclotransferase	-
OO788_RS08045 (1636438)	1636438..1636791	-	354	WP_001169661.1	DsrE/F sulfur relay family protein YchN	-
OO788_RS08050 (1636977)	1636977..1638371	+	1395	WP_000086192.1	inverse autotransporter invasin YchO	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 3971.74 Da
• Isoelectric Point: 11.4779

>T41957 WP_000170963.1 NZ_AP026090:c1633539-1633432 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Nucleotide

• Length: 108 bp

>T41957 NZ_AP026090:c1633539-1633432 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin

Nucleotide

• Length: 60 bp

>AT41957 NZ_AP026090:1633587-1633646 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Structures

Antitoxin