Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-ohsC/Ldr(toxin)
Location 4450412..4450633 Replicon chromosome
Accession NZ_AP026087
Organism Escherichia coli strain 8_140198

Toxin (Protein)


Gene name ldrD Uniprot ID S1NWX0
Locus tag OO841_RS22625 Protein ID WP_001295224.1
Coordinates 4450412..4450519 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name ohsC
Locus tag -
Coordinates 4450568..4450633 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OO841_RS22600 (4445665) 4445665..4446417 - 753 Protein_4424 cellulose biosynthesis protein BcsQ -
OO841_RS22605 (4446429) 4446429..4446617 - 189 WP_001063316.1 cellulose biosynthesis protein BcsR -
OO841_RS22610 (4446890) 4446890..4448461 + 1572 WP_001204920.1 cellulose biosynthesis c-di-GMP-binding protein BcsE -
OO841_RS22615 (4448458) 4448458..4448649 + 192 WP_000988308.1 cellulose biosynthesis protein BcsF -
OO841_RS22620 (4448646) 4448646..4450325 + 1680 WP_000191596.1 cellulose biosynthesis protein BcsG -
OO841_RS22625 (4450412) 4450412..4450519 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (4450568) 4450568..4450633 + 66 NuclAT_16 - Antitoxin
- (4450568) 4450568..4450633 + 66 NuclAT_16 - Antitoxin
- (4450568) 4450568..4450633 + 66 NuclAT_16 - Antitoxin
- (4450568) 4450568..4450633 + 66 NuclAT_16 - Antitoxin
- (4450568) 4450568..4450633 + 66 NuclAT_21 - Antitoxin
- (4450568) 4450568..4450633 + 66 NuclAT_21 - Antitoxin
- (4450568) 4450568..4450633 + 66 NuclAT_21 - Antitoxin
- (4450568) 4450568..4450633 + 66 NuclAT_21 - Antitoxin
OO841_RS22630 (4450995) 4450995..4452266 + 1272 WP_001301684.1 aromatic amino acid transport family protein -
OO841_RS22635 (4452296) 4452296..4453300 - 1005 WP_000107027.1 dipeptide ABC transporter ATP-binding subunit DppF -
OO841_RS22640 (4453297) 4453297..4454280 - 984 WP_001196486.1 dipeptide ABC transporter ATP-binding protein -
OO841_RS22645 (4454291) 4454291..4455193 - 903 WP_000084677.1 dipeptide ABC transporter permease DppC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3882.70 Da        Isoelectric Point: 9.0157

>T41939 WP_001295224.1 NZ_AP026087:c4450519-4450412 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK

Download         Length: 108 bp

>T41939 NZ_AP026087:c4450519-4450412 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA

Antitoxin


Download         Length: 66 bp

>AT41939 NZ_AP026087:4450568-4450633 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TSJ7

Antitoxin

Download structure file

References