Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-ohsC/Ldr(toxin) |
| Location | 4450412..4450633 | Replicon | chromosome |
| Accession | NZ_AP026087 | ||
| Organism | Escherichia coli strain 8_140198 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1NWX0 |
| Locus tag | OO841_RS22625 | Protein ID | WP_001295224.1 |
| Coordinates | 4450412..4450519 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | ohsC | ||
| Locus tag | - | ||
| Coordinates | 4450568..4450633 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OO841_RS22600 (4445665) | 4445665..4446417 | - | 753 | Protein_4424 | cellulose biosynthesis protein BcsQ | - |
| OO841_RS22605 (4446429) | 4446429..4446617 | - | 189 | WP_001063316.1 | cellulose biosynthesis protein BcsR | - |
| OO841_RS22610 (4446890) | 4446890..4448461 | + | 1572 | WP_001204920.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
| OO841_RS22615 (4448458) | 4448458..4448649 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| OO841_RS22620 (4448646) | 4448646..4450325 | + | 1680 | WP_000191596.1 | cellulose biosynthesis protein BcsG | - |
| OO841_RS22625 (4450412) | 4450412..4450519 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - (4450568) | 4450568..4450633 | + | 66 | NuclAT_16 | - | Antitoxin |
| - (4450568) | 4450568..4450633 | + | 66 | NuclAT_16 | - | Antitoxin |
| - (4450568) | 4450568..4450633 | + | 66 | NuclAT_16 | - | Antitoxin |
| - (4450568) | 4450568..4450633 | + | 66 | NuclAT_16 | - | Antitoxin |
| - (4450568) | 4450568..4450633 | + | 66 | NuclAT_21 | - | Antitoxin |
| - (4450568) | 4450568..4450633 | + | 66 | NuclAT_21 | - | Antitoxin |
| - (4450568) | 4450568..4450633 | + | 66 | NuclAT_21 | - | Antitoxin |
| - (4450568) | 4450568..4450633 | + | 66 | NuclAT_21 | - | Antitoxin |
| OO841_RS22630 (4450995) | 4450995..4452266 | + | 1272 | WP_001301684.1 | aromatic amino acid transport family protein | - |
| OO841_RS22635 (4452296) | 4452296..4453300 | - | 1005 | WP_000107027.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| OO841_RS22640 (4453297) | 4453297..4454280 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
| OO841_RS22645 (4454291) | 4454291..4455193 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T41939 WP_001295224.1 NZ_AP026087:c4450519-4450412 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T41939 NZ_AP026087:c4450519-4450412 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 66 bp
>AT41939 NZ_AP026087:4450568-4450633 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|