Detailed information of TA system TA041879

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-rdlD/Ldr(toxin)
• Location: 1657024..1657238
• Replicon: chromosome
• Accession: NZ_AP026085
• Organism: Escherichia coli strain H52_982342

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: J7R083
• Locus tag: OO840_RS08140
• Protein ID: WP_000170963.1
• Coordinates: 1657024..1657131 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	rdlD
Locus tag	-
Coordinates	1657179..1657238 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
OO840_RS08110 (1652333)	1652333..1653415	+	1083	WP_000804726.1	peptide chain release factor 1	-
OO840_RS08115 (1653415)	1653415..1654248	+	834	WP_000456466.1	peptide chain release factor N(5)-glutamine methyltransferase	-
OO840_RS08120 (1654245)	1654245..1654637	+	393	WP_000200379.1	invasion regulator SirB2	-
OO840_RS08125 (1654641)	1654641..1655450	+	810	WP_001257044.1	invasion regulator SirB1	-
OO840_RS08130 (1655486)	1655486..1656340	+	855	WP_000811067.1	3-deoxy-8-phosphooctulonate synthase	-
OO840_RS08135 (1656488)	1656488..1656595	-	108	WP_000170954.1	type I toxin-antitoxin system toxin Ldr family protein	-
- (1656648)	1656648..1656709	+	62	NuclAT_24	-	-
- (1656648)	1656648..1656709	+	62	NuclAT_24	-	-
- (1656648)	1656648..1656709	+	62	NuclAT_24	-	-
- (1656648)	1656648..1656709	+	62	NuclAT_24	-	-
- (1656648)	1656648..1656709	+	62	NuclAT_26	-	-
- (1656648)	1656648..1656709	+	62	NuclAT_26	-	-
- (1656648)	1656648..1656709	+	62	NuclAT_26	-	-
- (1656648)	1656648..1656709	+	62	NuclAT_26	-	-
- (1656648)	1656648..1656709	+	62	NuclAT_28	-	-
- (1656648)	1656648..1656709	+	62	NuclAT_28	-	-
- (1656648)	1656648..1656709	+	62	NuclAT_28	-	-
- (1656648)	1656648..1656709	+	62	NuclAT_28	-	-
- (1656648)	1656648..1656709	+	62	NuclAT_30	-	-
- (1656648)	1656648..1656709	+	62	NuclAT_30	-	-
- (1656648)	1656648..1656709	+	62	NuclAT_30	-	-
- (1656648)	1656648..1656709	+	62	NuclAT_30	-	-
- (1656648)	1656648..1656709	+	62	NuclAT_32	-	-
- (1656648)	1656648..1656709	+	62	NuclAT_32	-	-
- (1656648)	1656648..1656709	+	62	NuclAT_32	-	-
- (1656648)	1656648..1656709	+	62	NuclAT_32	-	-
- (1656648)	1656648..1656710	+	63	NuclAT_17	-	-
- (1656648)	1656648..1656710	+	63	NuclAT_17	-	-
- (1656648)	1656648..1656710	+	63	NuclAT_17	-	-
- (1656648)	1656648..1656710	+	63	NuclAT_17	-	-
- (1656648)	1656648..1656710	+	63	NuclAT_18	-	-
- (1656648)	1656648..1656710	+	63	NuclAT_18	-	-
- (1656648)	1656648..1656710	+	63	NuclAT_18	-	-
- (1656648)	1656648..1656710	+	63	NuclAT_18	-	-
- (1656648)	1656648..1656710	+	63	NuclAT_19	-	-
- (1656648)	1656648..1656710	+	63	NuclAT_19	-	-
- (1656648)	1656648..1656710	+	63	NuclAT_19	-	-
- (1656648)	1656648..1656710	+	63	NuclAT_19	-	-
- (1656648)	1656648..1656710	+	63	NuclAT_20	-	-
- (1656648)	1656648..1656710	+	63	NuclAT_20	-	-
- (1656648)	1656648..1656710	+	63	NuclAT_20	-	-
- (1656648)	1656648..1656710	+	63	NuclAT_20	-	-
- (1656648)	1656648..1656710	+	63	NuclAT_22	-	-
- (1656648)	1656648..1656710	+	63	NuclAT_22	-	-
- (1656648)	1656648..1656710	+	63	NuclAT_22	-	-
- (1656648)	1656648..1656710	+	63	NuclAT_22	-	-
- (1656648)	1656648..1656710	+	63	NuclAT_23	-	-
- (1656648)	1656648..1656710	+	63	NuclAT_23	-	-
- (1656648)	1656648..1656710	+	63	NuclAT_23	-	-
- (1656648)	1656648..1656710	+	63	NuclAT_23	-	-
OO840_RS08140 (1657024)	1657024..1657131	-	108	WP_000170963.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
- (1657179)	1657179..1657238	+	60	NuclAT_25	-	Antitoxin
- (1657179)	1657179..1657238	+	60	NuclAT_25	-	Antitoxin
- (1657179)	1657179..1657238	+	60	NuclAT_25	-	Antitoxin
- (1657179)	1657179..1657238	+	60	NuclAT_25	-	Antitoxin
- (1657179)	1657179..1657238	+	60	NuclAT_27	-	Antitoxin
- (1657179)	1657179..1657238	+	60	NuclAT_27	-	Antitoxin
- (1657179)	1657179..1657238	+	60	NuclAT_27	-	Antitoxin
- (1657179)	1657179..1657238	+	60	NuclAT_27	-	Antitoxin
- (1657179)	1657179..1657238	+	60	NuclAT_29	-	Antitoxin
- (1657179)	1657179..1657238	+	60	NuclAT_29	-	Antitoxin
- (1657179)	1657179..1657238	+	60	NuclAT_29	-	Antitoxin
- (1657179)	1657179..1657238	+	60	NuclAT_29	-	Antitoxin
- (1657179)	1657179..1657238	+	60	NuclAT_31	-	Antitoxin
- (1657179)	1657179..1657238	+	60	NuclAT_31	-	Antitoxin
- (1657179)	1657179..1657238	+	60	NuclAT_31	-	Antitoxin
- (1657179)	1657179..1657238	+	60	NuclAT_31	-	Antitoxin
- (1657179)	1657179..1657238	+	60	NuclAT_33	-	Antitoxin
- (1657179)	1657179..1657238	+	60	NuclAT_33	-	Antitoxin
- (1657179)	1657179..1657238	+	60	NuclAT_33	-	Antitoxin
- (1657179)	1657179..1657238	+	60	NuclAT_33	-	Antitoxin
OO840_RS08145 (1657530)	1657530..1658630	-	1101	WP_001301956.1	sodium-potassium/proton antiporter ChaA	-
OO840_RS08150 (1658900)	1658900..1659130	+	231	WP_001146444.1	putative cation transport regulator ChaB	-
OO840_RS08155 (1659291)	1659291..1659986	+	696	WP_001301489.1	glutathione-specific gamma-glutamylcyclotransferase	-
OO840_RS08160 (1660030)	1660030..1660383	-	354	WP_001169661.1	DsrE/F sulfur relay family protein YchN	-
OO840_RS08165 (1660569)	1660569..1661963	+	1395	WP_000086192.1	inverse autotransporter invasin YchO	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 3971.74 Da
• Isoelectric Point: 11.4779

>T41879 WP_000170963.1 NZ_AP026085:c1657131-1657024 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Nucleotide

• Length: 108 bp

>T41879 NZ_AP026085:c1657131-1657024 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin

Nucleotide

• Length: 60 bp

>AT41879 NZ_AP026085:1657179-1657238 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Structures

Antitoxin