Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-ohsC/Ldr(toxin)
Location 4428197..4428418 Replicon chromosome
Accession NZ_AP026082
Organism Escherichia coli strain F765

Toxin (Protein)


Gene name ldrD Uniprot ID S1NWX0
Locus tag OO934_RS22350 Protein ID WP_001295224.1
Coordinates 4428197..4428304 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name ohsC
Locus tag -
Coordinates 4428353..4428418 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OO934_RS22325 (4423450) 4423450..4424202 - 753 Protein_4376 cellulose biosynthesis protein BcsQ -
OO934_RS22330 (4424214) 4424214..4424402 - 189 WP_001063316.1 cellulose biosynthesis protein BcsR -
OO934_RS22335 (4424675) 4424675..4426246 + 1572 WP_001204920.1 cellulose biosynthesis c-di-GMP-binding protein BcsE -
OO934_RS22340 (4426243) 4426243..4426434 + 192 WP_000988308.1 cellulose biosynthesis protein BcsF -
OO934_RS22345 (4426431) 4426431..4428110 + 1680 WP_000191596.1 cellulose biosynthesis protein BcsG -
OO934_RS22350 (4428197) 4428197..4428304 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (4428353) 4428353..4428418 + 66 NuclAT_16 - Antitoxin
- (4428353) 4428353..4428418 + 66 NuclAT_16 - Antitoxin
- (4428353) 4428353..4428418 + 66 NuclAT_16 - Antitoxin
- (4428353) 4428353..4428418 + 66 NuclAT_16 - Antitoxin
- (4428353) 4428353..4428418 + 66 NuclAT_21 - Antitoxin
- (4428353) 4428353..4428418 + 66 NuclAT_21 - Antitoxin
- (4428353) 4428353..4428418 + 66 NuclAT_21 - Antitoxin
- (4428353) 4428353..4428418 + 66 NuclAT_21 - Antitoxin
OO934_RS22355 (4428780) 4428780..4430051 + 1272 WP_001301684.1 aromatic amino acid transport family protein -
OO934_RS22360 (4430081) 4430081..4431085 - 1005 WP_000107027.1 dipeptide ABC transporter ATP-binding subunit DppF -
OO934_RS22365 (4431082) 4431082..4432065 - 984 WP_001196486.1 dipeptide ABC transporter ATP-binding protein -
OO934_RS22370 (4432076) 4432076..4432978 - 903 WP_000084677.1 dipeptide ABC transporter permease DppC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3882.70 Da        Isoelectric Point: 9.0157

>T41863 WP_001295224.1 NZ_AP026082:c4428304-4428197 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK

Download         Length: 108 bp

>T41863 NZ_AP026082:c4428304-4428197 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA

Antitoxin


Download         Length: 66 bp

>AT41863 NZ_AP026082:4428353-4428418 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TSJ7

Antitoxin

Download structure file

References