Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2083021..2083246 | Replicon | chromosome |
| Accession | NZ_AP026082 | ||
| Organism | Escherichia coli strain F765 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
| Locus tag | OO934_RS10290 | Protein ID | WP_000813258.1 |
| Coordinates | 2083021..2083176 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 2083188..2083246 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OO934_RS10240 | 2078024..2078455 | - | 432 | WP_001302123.1 | tellurite resistance protein | - |
| OO934_RS10255 | 2078906..2079619 | - | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
| OO934_RS10260 | 2079755..2079952 | - | 198 | WP_000917763.1 | hypothetical protein | - |
| OO934_RS10265 | 2080177..2080731 | - | 555 | WP_000640035.1 | DUF1133 family protein | - |
| OO934_RS10270 | 2080794..2081099 | - | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
| OO934_RS10275 | 2081112..2082161 | - | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
| OO934_RS10280 | 2082163..2082435 | - | 273 | WP_000191871.1 | hypothetical protein | - |
| OO934_RS10285 | 2082557..2082901 | - | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
| OO934_RS10290 | 2083021..2083176 | - | 156 | WP_000813258.1 | Hok/Gef family protein | Toxin |
| - | 2083188..2083246 | + | 59 | - | - | Antitoxin |
| OO934_RS10295 | 2083467..2084024 | - | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
| OO934_RS10300 | 2084026..2084244 | - | 219 | WP_000683609.1 | DUF4014 family protein | - |
| OO934_RS10305 | 2084372..2084683 | - | 312 | WP_001289673.1 | hypothetical protein | - |
| OO934_RS10310 | 2084676..2084903 | - | 228 | WP_000699809.1 | hypothetical protein | - |
| OO934_RS10315 | 2084900..2085181 | - | 282 | WP_000603384.1 | DNA-binding protein | - |
| OO934_RS10320 | 2085214..2085930 | - | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
| OO934_RS10325 | 2085964..2086425 | - | 462 | WP_000139447.1 | replication protein P | - |
| OO934_RS10330 | 2086418..2087473 | - | 1056 | WP_001356791.1 | DnaT-like ssDNA-binding domain-containing protein | - |
| OO934_RS10335 | 2087542..2087967 | - | 426 | WP_000693878.1 | toxin YdaT family protein | - |
| OO934_RS10340 | 2087951..2088194 | - | 244 | Protein_2031 | Cro/CI family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | nleG7' | 2045575..2150330 | 104755 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T41845 WP_000813258.1 NZ_AP026082:c2083176-2083021 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
>T41845 NZ_AP026082:c2083176-2083021 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
Antitoxin
Download Length: 59 bp
>AT41845 NZ_AP026082:2083188-2083246 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|