Detailed information of TA system
Overview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 1655704..1655918 | Replicon | chromosome |
Accession | NZ_AP026082 | ||
Organism | Escherichia coli strain F765 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | J7R083 |
Locus tag | OO934_RS08130 | Protein ID | WP_000170963.1 |
Coordinates | 1655704..1655811 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 1655859..1655918 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OO934_RS08100 (1651013) | 1651013..1652095 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
OO934_RS08105 (1652095) | 1652095..1652928 | + | 834 | WP_000456466.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
OO934_RS08110 (1652925) | 1652925..1653317 | + | 393 | WP_000200379.1 | invasion regulator SirB2 | - |
OO934_RS08115 (1653321) | 1653321..1654130 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
OO934_RS08120 (1654166) | 1654166..1655020 | + | 855 | WP_000811067.1 | 3-deoxy-8-phosphooctulonate synthase | - |
OO934_RS08125 (1655168) | 1655168..1655275 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- (1655328) | 1655328..1655389 | + | 62 | NuclAT_24 | - | - |
- (1655328) | 1655328..1655389 | + | 62 | NuclAT_24 | - | - |
- (1655328) | 1655328..1655389 | + | 62 | NuclAT_24 | - | - |
- (1655328) | 1655328..1655389 | + | 62 | NuclAT_24 | - | - |
- (1655328) | 1655328..1655389 | + | 62 | NuclAT_26 | - | - |
- (1655328) | 1655328..1655389 | + | 62 | NuclAT_26 | - | - |
- (1655328) | 1655328..1655389 | + | 62 | NuclAT_26 | - | - |
- (1655328) | 1655328..1655389 | + | 62 | NuclAT_26 | - | - |
- (1655328) | 1655328..1655389 | + | 62 | NuclAT_28 | - | - |
- (1655328) | 1655328..1655389 | + | 62 | NuclAT_28 | - | - |
- (1655328) | 1655328..1655389 | + | 62 | NuclAT_28 | - | - |
- (1655328) | 1655328..1655389 | + | 62 | NuclAT_28 | - | - |
- (1655328) | 1655328..1655389 | + | 62 | NuclAT_30 | - | - |
- (1655328) | 1655328..1655389 | + | 62 | NuclAT_30 | - | - |
- (1655328) | 1655328..1655389 | + | 62 | NuclAT_30 | - | - |
- (1655328) | 1655328..1655389 | + | 62 | NuclAT_30 | - | - |
- (1655328) | 1655328..1655389 | + | 62 | NuclAT_32 | - | - |
- (1655328) | 1655328..1655389 | + | 62 | NuclAT_32 | - | - |
- (1655328) | 1655328..1655389 | + | 62 | NuclAT_32 | - | - |
- (1655328) | 1655328..1655389 | + | 62 | NuclAT_32 | - | - |
- (1655328) | 1655328..1655390 | + | 63 | NuclAT_17 | - | - |
- (1655328) | 1655328..1655390 | + | 63 | NuclAT_17 | - | - |
- (1655328) | 1655328..1655390 | + | 63 | NuclAT_17 | - | - |
- (1655328) | 1655328..1655390 | + | 63 | NuclAT_17 | - | - |
- (1655328) | 1655328..1655390 | + | 63 | NuclAT_18 | - | - |
- (1655328) | 1655328..1655390 | + | 63 | NuclAT_18 | - | - |
- (1655328) | 1655328..1655390 | + | 63 | NuclAT_18 | - | - |
- (1655328) | 1655328..1655390 | + | 63 | NuclAT_18 | - | - |
- (1655328) | 1655328..1655390 | + | 63 | NuclAT_19 | - | - |
- (1655328) | 1655328..1655390 | + | 63 | NuclAT_19 | - | - |
- (1655328) | 1655328..1655390 | + | 63 | NuclAT_19 | - | - |
- (1655328) | 1655328..1655390 | + | 63 | NuclAT_19 | - | - |
- (1655328) | 1655328..1655390 | + | 63 | NuclAT_20 | - | - |
- (1655328) | 1655328..1655390 | + | 63 | NuclAT_20 | - | - |
- (1655328) | 1655328..1655390 | + | 63 | NuclAT_20 | - | - |
- (1655328) | 1655328..1655390 | + | 63 | NuclAT_20 | - | - |
- (1655328) | 1655328..1655390 | + | 63 | NuclAT_22 | - | - |
- (1655328) | 1655328..1655390 | + | 63 | NuclAT_22 | - | - |
- (1655328) | 1655328..1655390 | + | 63 | NuclAT_22 | - | - |
- (1655328) | 1655328..1655390 | + | 63 | NuclAT_22 | - | - |
- (1655328) | 1655328..1655390 | + | 63 | NuclAT_23 | - | - |
- (1655328) | 1655328..1655390 | + | 63 | NuclAT_23 | - | - |
- (1655328) | 1655328..1655390 | + | 63 | NuclAT_23 | - | - |
- (1655328) | 1655328..1655390 | + | 63 | NuclAT_23 | - | - |
OO934_RS08130 (1655704) | 1655704..1655811 | - | 108 | WP_000170963.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- (1655859) | 1655859..1655918 | + | 60 | NuclAT_25 | - | Antitoxin |
- (1655859) | 1655859..1655918 | + | 60 | NuclAT_25 | - | Antitoxin |
- (1655859) | 1655859..1655918 | + | 60 | NuclAT_25 | - | Antitoxin |
- (1655859) | 1655859..1655918 | + | 60 | NuclAT_25 | - | Antitoxin |
- (1655859) | 1655859..1655918 | + | 60 | NuclAT_27 | - | Antitoxin |
- (1655859) | 1655859..1655918 | + | 60 | NuclAT_27 | - | Antitoxin |
- (1655859) | 1655859..1655918 | + | 60 | NuclAT_27 | - | Antitoxin |
- (1655859) | 1655859..1655918 | + | 60 | NuclAT_27 | - | Antitoxin |
- (1655859) | 1655859..1655918 | + | 60 | NuclAT_29 | - | Antitoxin |
- (1655859) | 1655859..1655918 | + | 60 | NuclAT_29 | - | Antitoxin |
- (1655859) | 1655859..1655918 | + | 60 | NuclAT_29 | - | Antitoxin |
- (1655859) | 1655859..1655918 | + | 60 | NuclAT_29 | - | Antitoxin |
- (1655859) | 1655859..1655918 | + | 60 | NuclAT_31 | - | Antitoxin |
- (1655859) | 1655859..1655918 | + | 60 | NuclAT_31 | - | Antitoxin |
- (1655859) | 1655859..1655918 | + | 60 | NuclAT_31 | - | Antitoxin |
- (1655859) | 1655859..1655918 | + | 60 | NuclAT_31 | - | Antitoxin |
- (1655859) | 1655859..1655918 | + | 60 | NuclAT_33 | - | Antitoxin |
- (1655859) | 1655859..1655918 | + | 60 | NuclAT_33 | - | Antitoxin |
- (1655859) | 1655859..1655918 | + | 60 | NuclAT_33 | - | Antitoxin |
- (1655859) | 1655859..1655918 | + | 60 | NuclAT_33 | - | Antitoxin |
OO934_RS08135 (1656210) | 1656210..1657310 | - | 1101 | WP_001301956.1 | sodium-potassium/proton antiporter ChaA | - |
OO934_RS08140 (1657580) | 1657580..1657810 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
OO934_RS08145 (1657971) | 1657971..1658666 | + | 696 | WP_001301489.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
OO934_RS08150 (1658710) | 1658710..1659063 | - | 354 | WP_001169661.1 | DsrE/F sulfur relay family protein YchN | - |
OO934_RS08155 (1659249) | 1659249..1660643 | + | 1395 | WP_000086192.1 | inverse autotransporter invasin YchO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3971.74 Da Isoelectric Point: 11.4779
>T41842 WP_000170963.1 NZ_AP026082:c1655811-1655704 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T41842 NZ_AP026082:c1655811-1655704 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 60 bp
>AT41842 NZ_AP026082:1655859-1655918 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
GTCTGGTTTCAAGATTAGCCCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|