Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1655704..1655918 Replicon chromosome
Accession NZ_AP026082
Organism Escherichia coli strain F765

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag OO934_RS08130 Protein ID WP_000170963.1
Coordinates 1655704..1655811 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1655859..1655918 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OO934_RS08100 (1651013) 1651013..1652095 + 1083 WP_000804726.1 peptide chain release factor 1 -
OO934_RS08105 (1652095) 1652095..1652928 + 834 WP_000456466.1 peptide chain release factor N(5)-glutamine methyltransferase -
OO934_RS08110 (1652925) 1652925..1653317 + 393 WP_000200379.1 invasion regulator SirB2 -
OO934_RS08115 (1653321) 1653321..1654130 + 810 WP_001257044.1 invasion regulator SirB1 -
OO934_RS08120 (1654166) 1654166..1655020 + 855 WP_000811067.1 3-deoxy-8-phosphooctulonate synthase -
OO934_RS08125 (1655168) 1655168..1655275 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1655328) 1655328..1655389 + 62 NuclAT_24 - -
- (1655328) 1655328..1655389 + 62 NuclAT_24 - -
- (1655328) 1655328..1655389 + 62 NuclAT_24 - -
- (1655328) 1655328..1655389 + 62 NuclAT_24 - -
- (1655328) 1655328..1655389 + 62 NuclAT_26 - -
- (1655328) 1655328..1655389 + 62 NuclAT_26 - -
- (1655328) 1655328..1655389 + 62 NuclAT_26 - -
- (1655328) 1655328..1655389 + 62 NuclAT_26 - -
- (1655328) 1655328..1655389 + 62 NuclAT_28 - -
- (1655328) 1655328..1655389 + 62 NuclAT_28 - -
- (1655328) 1655328..1655389 + 62 NuclAT_28 - -
- (1655328) 1655328..1655389 + 62 NuclAT_28 - -
- (1655328) 1655328..1655389 + 62 NuclAT_30 - -
- (1655328) 1655328..1655389 + 62 NuclAT_30 - -
- (1655328) 1655328..1655389 + 62 NuclAT_30 - -
- (1655328) 1655328..1655389 + 62 NuclAT_30 - -
- (1655328) 1655328..1655389 + 62 NuclAT_32 - -
- (1655328) 1655328..1655389 + 62 NuclAT_32 - -
- (1655328) 1655328..1655389 + 62 NuclAT_32 - -
- (1655328) 1655328..1655389 + 62 NuclAT_32 - -
- (1655328) 1655328..1655390 + 63 NuclAT_17 - -
- (1655328) 1655328..1655390 + 63 NuclAT_17 - -
- (1655328) 1655328..1655390 + 63 NuclAT_17 - -
- (1655328) 1655328..1655390 + 63 NuclAT_17 - -
- (1655328) 1655328..1655390 + 63 NuclAT_18 - -
- (1655328) 1655328..1655390 + 63 NuclAT_18 - -
- (1655328) 1655328..1655390 + 63 NuclAT_18 - -
- (1655328) 1655328..1655390 + 63 NuclAT_18 - -
- (1655328) 1655328..1655390 + 63 NuclAT_19 - -
- (1655328) 1655328..1655390 + 63 NuclAT_19 - -
- (1655328) 1655328..1655390 + 63 NuclAT_19 - -
- (1655328) 1655328..1655390 + 63 NuclAT_19 - -
- (1655328) 1655328..1655390 + 63 NuclAT_20 - -
- (1655328) 1655328..1655390 + 63 NuclAT_20 - -
- (1655328) 1655328..1655390 + 63 NuclAT_20 - -
- (1655328) 1655328..1655390 + 63 NuclAT_20 - -
- (1655328) 1655328..1655390 + 63 NuclAT_22 - -
- (1655328) 1655328..1655390 + 63 NuclAT_22 - -
- (1655328) 1655328..1655390 + 63 NuclAT_22 - -
- (1655328) 1655328..1655390 + 63 NuclAT_22 - -
- (1655328) 1655328..1655390 + 63 NuclAT_23 - -
- (1655328) 1655328..1655390 + 63 NuclAT_23 - -
- (1655328) 1655328..1655390 + 63 NuclAT_23 - -
- (1655328) 1655328..1655390 + 63 NuclAT_23 - -
OO934_RS08130 (1655704) 1655704..1655811 - 108 WP_000170963.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (1655859) 1655859..1655918 + 60 NuclAT_25 - Antitoxin
- (1655859) 1655859..1655918 + 60 NuclAT_25 - Antitoxin
- (1655859) 1655859..1655918 + 60 NuclAT_25 - Antitoxin
- (1655859) 1655859..1655918 + 60 NuclAT_25 - Antitoxin
- (1655859) 1655859..1655918 + 60 NuclAT_27 - Antitoxin
- (1655859) 1655859..1655918 + 60 NuclAT_27 - Antitoxin
- (1655859) 1655859..1655918 + 60 NuclAT_27 - Antitoxin
- (1655859) 1655859..1655918 + 60 NuclAT_27 - Antitoxin
- (1655859) 1655859..1655918 + 60 NuclAT_29 - Antitoxin
- (1655859) 1655859..1655918 + 60 NuclAT_29 - Antitoxin
- (1655859) 1655859..1655918 + 60 NuclAT_29 - Antitoxin
- (1655859) 1655859..1655918 + 60 NuclAT_29 - Antitoxin
- (1655859) 1655859..1655918 + 60 NuclAT_31 - Antitoxin
- (1655859) 1655859..1655918 + 60 NuclAT_31 - Antitoxin
- (1655859) 1655859..1655918 + 60 NuclAT_31 - Antitoxin
- (1655859) 1655859..1655918 + 60 NuclAT_31 - Antitoxin
- (1655859) 1655859..1655918 + 60 NuclAT_33 - Antitoxin
- (1655859) 1655859..1655918 + 60 NuclAT_33 - Antitoxin
- (1655859) 1655859..1655918 + 60 NuclAT_33 - Antitoxin
- (1655859) 1655859..1655918 + 60 NuclAT_33 - Antitoxin
OO934_RS08135 (1656210) 1656210..1657310 - 1101 WP_001301956.1 sodium-potassium/proton antiporter ChaA -
OO934_RS08140 (1657580) 1657580..1657810 + 231 WP_001146444.1 putative cation transport regulator ChaB -
OO934_RS08145 (1657971) 1657971..1658666 + 696 WP_001301489.1 glutathione-specific gamma-glutamylcyclotransferase -
OO934_RS08150 (1658710) 1658710..1659063 - 354 WP_001169661.1 DsrE/F sulfur relay family protein YchN -
OO934_RS08155 (1659249) 1659249..1660643 + 1395 WP_000086192.1 inverse autotransporter invasin YchO -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T41842 WP_000170963.1 NZ_AP026082:c1655811-1655704 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T41842 NZ_AP026082:c1655811-1655704 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 60 bp

>AT41842 NZ_AP026082:1655859-1655918 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure


Antitoxin

Download structure file

References