Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 1176981..1177206 | Replicon | chromosome |
Accession | NZ_AP026082 | ||
Organism | Escherichia coli strain F765 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | - |
Locus tag | OO934_RS05470 | Protein ID | WP_000813263.1 |
Coordinates | 1177051..1177206 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 1176981..1177039 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OO934_RS05440 | 1172256..1173347 | + | 1092 | WP_001205823.1 | hypothetical protein | - |
OO934_RS05445 | 1173354..1174100 | + | 747 | WP_000788745.1 | ATP-binding protein | - |
OO934_RS05450 | 1174122..1174892 | + | 771 | WP_000450992.1 | DUF1627 domain-containing protein | - |
OO934_RS05455 | 1174908..1175321 | + | 414 | WP_001151233.1 | DUF977 family protein | - |
OO934_RS05460 | 1175673..1176446 | - | 774 | WP_000160654.1 | alpha/beta hydrolase | - |
- | 1176981..1177039 | - | 59 | - | - | Antitoxin |
OO934_RS05470 | 1177051..1177206 | + | 156 | WP_000813263.1 | type I toxin-antitoxin system toxin HokD | Toxin |
OO934_RS05475 | 1177374..1177652 | + | 279 | WP_001341388.1 | hypothetical protein | - |
OO934_RS05480 | 1177654..1178703 | + | 1050 | WP_001265172.1 | DUF968 domain-containing protein | - |
OO934_RS05485 | 1178716..1179087 | + | 372 | WP_001217436.1 | RusA family crossover junction endodeoxyribonuclease | - |
OO934_RS05490 | 1179077..1179448 | + | 372 | WP_000090264.1 | antiterminator Q family protein | - |
OO934_RS05495 | 1179600..1180418 | + | 819 | WP_000265265.1 | CPBP family intramembrane metalloprotease | - |
OO934_RS05500 | 1180705..1180901 | + | 197 | Protein_1077 | TrmB family transcriptional regulator | - |
OO934_RS05505 | 1181039..1181752 | + | 714 | WP_000261909.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5722.86 Da Isoelectric Point: 6.1531
>T41839 WP_000813263.1 NZ_AP026082:1177051-1177206 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T41839 NZ_AP026082:1177051-1177206 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT41839 NZ_AP026082:c1177039-1176981 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|