Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-ohsC/Ldr(toxin) |
Location | 4426970..4427191 | Replicon | chromosome |
Accession | NZ_AP026080 | ||
Organism | Escherichia coli strain F690 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1NWX0 |
Locus tag | OO857_RS22285 | Protein ID | WP_001295224.1 |
Coordinates | 4426970..4427077 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | ohsC | ||
Locus tag | - | ||
Coordinates | 4427126..4427191 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OO857_RS22260 (4422223) | 4422223..4422975 | - | 753 | Protein_4363 | cellulose biosynthesis protein BcsQ | - |
OO857_RS22265 (4422987) | 4422987..4423175 | - | 189 | WP_001063316.1 | cellulose biosynthesis protein BcsR | - |
OO857_RS22270 (4423448) | 4423448..4425019 | + | 1572 | WP_001204920.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
OO857_RS22275 (4425016) | 4425016..4425207 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
OO857_RS22280 (4425204) | 4425204..4426883 | + | 1680 | WP_000191596.1 | cellulose biosynthesis protein BcsG | - |
OO857_RS22285 (4426970) | 4426970..4427077 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- (4427126) | 4427126..4427191 | + | 66 | NuclAT_16 | - | Antitoxin |
- (4427126) | 4427126..4427191 | + | 66 | NuclAT_16 | - | Antitoxin |
- (4427126) | 4427126..4427191 | + | 66 | NuclAT_16 | - | Antitoxin |
- (4427126) | 4427126..4427191 | + | 66 | NuclAT_16 | - | Antitoxin |
- (4427126) | 4427126..4427191 | + | 66 | NuclAT_21 | - | Antitoxin |
- (4427126) | 4427126..4427191 | + | 66 | NuclAT_21 | - | Antitoxin |
- (4427126) | 4427126..4427191 | + | 66 | NuclAT_21 | - | Antitoxin |
- (4427126) | 4427126..4427191 | + | 66 | NuclAT_21 | - | Antitoxin |
OO857_RS22290 (4427553) | 4427553..4428824 | + | 1272 | WP_001301684.1 | aromatic amino acid transport family protein | - |
OO857_RS22295 (4428854) | 4428854..4429858 | - | 1005 | WP_000107027.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
OO857_RS22300 (4429855) | 4429855..4430838 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
OO857_RS22305 (4430849) | 4430849..4431751 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T41824 WP_001295224.1 NZ_AP026080:c4427077-4426970 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T41824 NZ_AP026080:c4427077-4426970 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 66 bp
>AT41824 NZ_AP026080:4427126-4427191 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|