Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-ohsC/Ldr(toxin)
Location 4426970..4427191 Replicon chromosome
Accession NZ_AP026080
Organism Escherichia coli strain F690

Toxin (Protein)


Gene name ldrD Uniprot ID S1NWX0
Locus tag OO857_RS22285 Protein ID WP_001295224.1
Coordinates 4426970..4427077 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name ohsC
Locus tag -
Coordinates 4427126..4427191 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OO857_RS22260 (4422223) 4422223..4422975 - 753 Protein_4363 cellulose biosynthesis protein BcsQ -
OO857_RS22265 (4422987) 4422987..4423175 - 189 WP_001063316.1 cellulose biosynthesis protein BcsR -
OO857_RS22270 (4423448) 4423448..4425019 + 1572 WP_001204920.1 cellulose biosynthesis c-di-GMP-binding protein BcsE -
OO857_RS22275 (4425016) 4425016..4425207 + 192 WP_000988308.1 cellulose biosynthesis protein BcsF -
OO857_RS22280 (4425204) 4425204..4426883 + 1680 WP_000191596.1 cellulose biosynthesis protein BcsG -
OO857_RS22285 (4426970) 4426970..4427077 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (4427126) 4427126..4427191 + 66 NuclAT_16 - Antitoxin
- (4427126) 4427126..4427191 + 66 NuclAT_16 - Antitoxin
- (4427126) 4427126..4427191 + 66 NuclAT_16 - Antitoxin
- (4427126) 4427126..4427191 + 66 NuclAT_16 - Antitoxin
- (4427126) 4427126..4427191 + 66 NuclAT_21 - Antitoxin
- (4427126) 4427126..4427191 + 66 NuclAT_21 - Antitoxin
- (4427126) 4427126..4427191 + 66 NuclAT_21 - Antitoxin
- (4427126) 4427126..4427191 + 66 NuclAT_21 - Antitoxin
OO857_RS22290 (4427553) 4427553..4428824 + 1272 WP_001301684.1 aromatic amino acid transport family protein -
OO857_RS22295 (4428854) 4428854..4429858 - 1005 WP_000107027.1 dipeptide ABC transporter ATP-binding subunit DppF -
OO857_RS22300 (4429855) 4429855..4430838 - 984 WP_001196486.1 dipeptide ABC transporter ATP-binding protein -
OO857_RS22305 (4430849) 4430849..4431751 - 903 WP_000084677.1 dipeptide ABC transporter permease DppC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3882.70 Da        Isoelectric Point: 9.0157

>T41824 WP_001295224.1 NZ_AP026080:c4427077-4426970 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK

Download         Length: 108 bp

>T41824 NZ_AP026080:c4427077-4426970 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA

Antitoxin


Download         Length: 66 bp

>AT41824 NZ_AP026080:4427126-4427191 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TSJ7

Antitoxin

Download structure file

References