Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2087007..2087232 | Replicon | chromosome |
Accession | NZ_AP026080 | ||
Organism | Escherichia coli strain F690 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
Locus tag | OO857_RS10305 | Protein ID | WP_000813258.1 |
Coordinates | 2087007..2087162 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 2087174..2087232 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OO857_RS10255 | 2082010..2082441 | - | 432 | WP_001302123.1 | tellurite resistance protein | - |
OO857_RS10270 | 2082892..2083605 | - | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
OO857_RS10275 | 2083741..2083938 | - | 198 | WP_000917763.1 | hypothetical protein | - |
OO857_RS10280 | 2084163..2084717 | - | 555 | WP_000640035.1 | DUF1133 family protein | - |
OO857_RS10285 | 2084780..2085085 | - | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
OO857_RS10290 | 2085098..2086147 | - | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
OO857_RS10295 | 2086149..2086421 | - | 273 | WP_000191871.1 | hypothetical protein | - |
OO857_RS10300 | 2086543..2086887 | - | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
OO857_RS10305 | 2087007..2087162 | - | 156 | WP_000813258.1 | Hok/Gef family protein | Toxin |
- | 2087174..2087232 | + | 59 | - | - | Antitoxin |
OO857_RS10310 | 2087453..2088010 | - | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
OO857_RS10315 | 2088012..2088230 | - | 219 | WP_000683609.1 | DUF4014 family protein | - |
OO857_RS10320 | 2088358..2088669 | - | 312 | WP_001289673.1 | hypothetical protein | - |
OO857_RS10325 | 2088662..2088889 | - | 228 | WP_000699809.1 | hypothetical protein | - |
OO857_RS10330 | 2088886..2089167 | - | 282 | WP_000603384.1 | DNA-binding protein | - |
OO857_RS10335 | 2089200..2089916 | - | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
OO857_RS10340 | 2089950..2090411 | - | 462 | WP_000139447.1 | replication protein P | - |
OO857_RS10345 | 2090404..2091459 | - | 1056 | WP_001356791.1 | DnaT-like ssDNA-binding domain-containing protein | - |
OO857_RS10350 | 2091528..2091953 | - | 426 | WP_000693878.1 | toxin YdaT family protein | - |
OO857_RS10355 | 2091937..2092180 | - | 244 | Protein_2034 | Cro/CI family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | nleG7' | 2049561..2154317 | 104756 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T41806 WP_000813258.1 NZ_AP026080:c2087162-2087007 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
>T41806 NZ_AP026080:c2087162-2087007 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
Antitoxin
Download Length: 59 bp
>AT41806 NZ_AP026080:2087174-2087232 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|