Detailed information of TA system TA040829

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-rdlD/Ldr(toxin)
• Location: 1536873..1537093
• Replicon: chromosome
• Accession: NZ_AP025754
• Organism: Escherichia sp. KS167_9B strain KS-P079

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: B7LGX8
• Locus tag: QUE34_RS07630
• Protein ID: WP_000170965.1
• Coordinates: 1536873..1536980 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	rdlD
Locus tag	-
Coordinates	1537027..1537093 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QUE34_RS07605	1532702..1533784	+	1083	WP_000804726.1	peptide chain release factor 1	-
QUE34_RS07610	1533784..1534617	+	834	WP_000456456.1	peptide chain release factor N(5)-glutamine methyltransferase	-
QUE34_RS07615	1534614..1535006	+	393	WP_000200378.1	invasion regulator SirB2	-
QUE34_RS07620	1535010..1535819	+	810	WP_001257058.1	invasion regulator SirB1	-
QUE34_RS07625	1535855..1536709	+	855	WP_103253927.1	3-deoxy-8-phosphooctulonate synthase	-
QUE34_RS07630	1536873..1536980	-	108	WP_000170965.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
-	1537027..1537093	+	67	-	-	Antitoxin
QUE34_RS07635	1537408..1537515	-	108	WP_000170956.1	type I toxin-antitoxin system toxin Ldr family protein	-
-	1537568..1537629	+	62	NuclAT_12	-	-
-	1537568..1537629	+	62	NuclAT_12	-	-
-	1537568..1537629	+	62	NuclAT_12	-	-
-	1537568..1537629	+	62	NuclAT_12	-	-
-	1537568..1537629	+	62	NuclAT_14	-	-
-	1537568..1537629	+	62	NuclAT_14	-	-
-	1537568..1537629	+	62	NuclAT_14	-	-
-	1537568..1537629	+	62	NuclAT_14	-	-
-	1537568..1537629	+	62	NuclAT_16	-	-
-	1537568..1537629	+	62	NuclAT_16	-	-
-	1537568..1537629	+	62	NuclAT_16	-	-
-	1537568..1537629	+	62	NuclAT_16	-	-
-	1537568..1537629	+	62	NuclAT_18	-	-
-	1537568..1537629	+	62	NuclAT_18	-	-
-	1537568..1537629	+	62	NuclAT_18	-	-
-	1537568..1537629	+	62	NuclAT_18	-	-
-	1537568..1537629	+	62	NuclAT_20	-	-
-	1537568..1537629	+	62	NuclAT_20	-	-
-	1537568..1537629	+	62	NuclAT_20	-	-
-	1537568..1537629	+	62	NuclAT_20	-	-
-	1537568..1537629	+	62	NuclAT_22	-	-
-	1537568..1537629	+	62	NuclAT_22	-	-
-	1537568..1537629	+	62	NuclAT_22	-	-
-	1537568..1537629	+	62	NuclAT_22	-	-
-	1537568..1537630	+	63	NuclAT_26	-	-
-	1537568..1537630	+	63	NuclAT_26	-	-
-	1537568..1537630	+	63	NuclAT_26	-	-
-	1537568..1537630	+	63	NuclAT_26	-	-
-	1537568..1537630	+	63	NuclAT_30	-	-
-	1537568..1537630	+	63	NuclAT_30	-	-
-	1537568..1537630	+	63	NuclAT_30	-	-
-	1537568..1537630	+	63	NuclAT_30	-	-
-	1537568..1537630	+	63	NuclAT_34	-	-
-	1537568..1537630	+	63	NuclAT_34	-	-
-	1537568..1537630	+	63	NuclAT_34	-	-
-	1537568..1537630	+	63	NuclAT_34	-	-
-	1537568..1537630	+	63	NuclAT_38	-	-
-	1537568..1537630	+	63	NuclAT_38	-	-
-	1537568..1537630	+	63	NuclAT_38	-	-
-	1537568..1537630	+	63	NuclAT_38	-	-
-	1537568..1537630	+	63	NuclAT_42	-	-
-	1537568..1537630	+	63	NuclAT_42	-	-
-	1537568..1537630	+	63	NuclAT_42	-	-
-	1537568..1537630	+	63	NuclAT_42	-	-
-	1537568..1537631	+	64	NuclAT_24	-	-
-	1537568..1537631	+	64	NuclAT_24	-	-
-	1537568..1537631	+	64	NuclAT_24	-	-
-	1537568..1537631	+	64	NuclAT_24	-	-
-	1537568..1537631	+	64	NuclAT_28	-	-
-	1537568..1537631	+	64	NuclAT_28	-	-
-	1537568..1537631	+	64	NuclAT_28	-	-
-	1537568..1537631	+	64	NuclAT_28	-	-
-	1537568..1537631	+	64	NuclAT_32	-	-
-	1537568..1537631	+	64	NuclAT_32	-	-
-	1537568..1537631	+	64	NuclAT_32	-	-
-	1537568..1537631	+	64	NuclAT_32	-	-
-	1537568..1537631	+	64	NuclAT_36	-	-
-	1537568..1537631	+	64	NuclAT_36	-	-
-	1537568..1537631	+	64	NuclAT_36	-	-
-	1537568..1537631	+	64	NuclAT_36	-	-
-	1537568..1537631	+	64	NuclAT_40	-	-
-	1537568..1537631	+	64	NuclAT_40	-	-
-	1537568..1537631	+	64	NuclAT_40	-	-
-	1537568..1537631	+	64	NuclAT_40	-	-
-	1537568..1537631	+	64	NuclAT_44	-	-
-	1537568..1537631	+	64	NuclAT_44	-	-
-	1537568..1537631	+	64	NuclAT_44	-	-
-	1537568..1537631	+	64	NuclAT_44	-	-
QUE34_RS07640	1537921..1539021	-	1101	WP_103253928.1	sodium-potassium/proton antiporter ChaA	-
QUE34_RS07645	1539290..1539520	+	231	WP_001146444.1	putative cation transport regulator ChaB	-
QUE34_RS07650	1539677..1540372	+	696	Protein_1495	glutathione-specific gamma-glutamylcyclotransferase	-
QUE34_RS07655	1540417..1540770	-	354	WP_103253929.1	DsrE/F sulfur relay family protein YchN	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 4001.77 Da
• Isoelectric Point: 11.4779

>T40829 WP_000170965.1 NZ_AP025754:c1536980-1536873 [Escherichia sp. KS167_9B]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Nucleotide

• Length: 108 bp

>T40829 NZ_AP025754:c1536980-1536873 [Escherichia sp. KS167_9B]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin

Nucleotide

• Length: 67 bp

>AT40829 NZ_AP025754:1537027-1537093 [Escherichia sp. KS167_9B]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCT

Structures

Toxin

• AlphaFold DB: A0A0E0Y029

Antitoxin