Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1587328..1587548 Replicon chromosome
Accession NZ_AP025751
Organism Escherichia sp. HH154_1D strain HH-P049

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag QUE53_RS07825 Protein ID WP_000170965.1
Coordinates 1587328..1587435 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1587482..1587548 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QUE53_RS07800 1583173..1584255 + 1083 WP_000804741.1 peptide chain release factor 1 -
QUE53_RS07805 1584255..1585088 + 834 WP_000456452.1 peptide chain release factor N(5)-glutamine methyltransferase -
QUE53_RS07810 1585085..1585477 + 393 WP_000200378.1 invasion regulator SirB2 -
QUE53_RS07815 1585481..1586290 + 810 WP_286347544.1 invasion regulator SirB1 -
QUE53_RS07820 1586326..1587180 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
QUE53_RS07825 1587328..1587435 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 1587482..1587548 + 67 - - Antitoxin
QUE53_RS07830 1587863..1587970 - 108 WP_000170956.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1588023..1588084 + 62 NuclAT_13 - -
- 1588023..1588084 + 62 NuclAT_13 - -
- 1588023..1588084 + 62 NuclAT_13 - -
- 1588023..1588084 + 62 NuclAT_13 - -
- 1588023..1588084 + 62 NuclAT_15 - -
- 1588023..1588084 + 62 NuclAT_15 - -
- 1588023..1588084 + 62 NuclAT_15 - -
- 1588023..1588084 + 62 NuclAT_15 - -
- 1588023..1588084 + 62 NuclAT_17 - -
- 1588023..1588084 + 62 NuclAT_17 - -
- 1588023..1588084 + 62 NuclAT_17 - -
- 1588023..1588084 + 62 NuclAT_17 - -
- 1588023..1588084 + 62 NuclAT_19 - -
- 1588023..1588084 + 62 NuclAT_19 - -
- 1588023..1588084 + 62 NuclAT_19 - -
- 1588023..1588084 + 62 NuclAT_19 - -
- 1588023..1588084 + 62 NuclAT_21 - -
- 1588023..1588084 + 62 NuclAT_21 - -
- 1588023..1588084 + 62 NuclAT_21 - -
- 1588023..1588084 + 62 NuclAT_21 - -
- 1588023..1588084 + 62 NuclAT_23 - -
- 1588023..1588084 + 62 NuclAT_23 - -
- 1588023..1588084 + 62 NuclAT_23 - -
- 1588023..1588084 + 62 NuclAT_23 - -
- 1588023..1588085 + 63 NuclAT_27 - -
- 1588023..1588085 + 63 NuclAT_27 - -
- 1588023..1588085 + 63 NuclAT_27 - -
- 1588023..1588085 + 63 NuclAT_27 - -
- 1588023..1588085 + 63 NuclAT_31 - -
- 1588023..1588085 + 63 NuclAT_31 - -
- 1588023..1588085 + 63 NuclAT_31 - -
- 1588023..1588085 + 63 NuclAT_31 - -
- 1588023..1588085 + 63 NuclAT_35 - -
- 1588023..1588085 + 63 NuclAT_35 - -
- 1588023..1588085 + 63 NuclAT_35 - -
- 1588023..1588085 + 63 NuclAT_35 - -
- 1588023..1588085 + 63 NuclAT_39 - -
- 1588023..1588085 + 63 NuclAT_39 - -
- 1588023..1588085 + 63 NuclAT_39 - -
- 1588023..1588085 + 63 NuclAT_39 - -
- 1588023..1588085 + 63 NuclAT_43 - -
- 1588023..1588085 + 63 NuclAT_43 - -
- 1588023..1588085 + 63 NuclAT_43 - -
- 1588023..1588085 + 63 NuclAT_43 - -
- 1588023..1588086 + 64 NuclAT_25 - -
- 1588023..1588086 + 64 NuclAT_25 - -
- 1588023..1588086 + 64 NuclAT_25 - -
- 1588023..1588086 + 64 NuclAT_25 - -
- 1588023..1588086 + 64 NuclAT_29 - -
- 1588023..1588086 + 64 NuclAT_29 - -
- 1588023..1588086 + 64 NuclAT_29 - -
- 1588023..1588086 + 64 NuclAT_29 - -
- 1588023..1588086 + 64 NuclAT_33 - -
- 1588023..1588086 + 64 NuclAT_33 - -
- 1588023..1588086 + 64 NuclAT_33 - -
- 1588023..1588086 + 64 NuclAT_33 - -
- 1588023..1588086 + 64 NuclAT_37 - -
- 1588023..1588086 + 64 NuclAT_37 - -
- 1588023..1588086 + 64 NuclAT_37 - -
- 1588023..1588086 + 64 NuclAT_37 - -
- 1588023..1588086 + 64 NuclAT_41 - -
- 1588023..1588086 + 64 NuclAT_41 - -
- 1588023..1588086 + 64 NuclAT_41 - -
- 1588023..1588086 + 64 NuclAT_41 - -
QUE53_RS07835 1588376..1589476 - 1101 WP_001306585.1 sodium-potassium/proton antiporter ChaA -
QUE53_RS07840 1589746..1589976 + 231 WP_001146444.1 putative cation transport regulator ChaB -
QUE53_RS07845 1590133..1590828 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
QUE53_RS07850 1590872..1591225 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T40783 WP_000170965.1 NZ_AP025751:c1587435-1587328 [Escherichia sp. HH154_1D]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T40783 NZ_AP025751:c1587435-1587328 [Escherichia sp. HH154_1D]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT40783 NZ_AP025751:1587482-1587548 [Escherichia sp. HH154_1D]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References