Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 79279..79532 Replicon plasmid pla1
Accession NZ_AP025748
Organism Escherichia sp. HH091_1A strain HH-P024

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag QUF14_RS27625 Protein ID WP_001312851.1
Coordinates 79279..79428 (-) Length 50 a.a.

Antitoxin (RNA)


Gene name sok
Locus tag -
Coordinates 79476..79532 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QUF14_RS27590 (74561) 74561..74848 - 288 WP_174498321.1 helix-turn-helix transcriptional regulator -
QUF14_RS27595 (74848) 74848..75033 - 186 Protein_91 type II toxin-antitoxin system RelE/ParE family toxin -
QUF14_RS27600 (75079) 75079..76449 + 1371 Protein_92 IS3-like element IS150 family transposase -
QUF14_RS27605 (76475) 76475..76606 - 132 Protein_93 type II toxin-antitoxin system RelE/ParE family toxin -
QUF14_RS27610 (77579) 77579..78436 - 858 WP_000829162.1 incFII family plasmid replication initiator RepA -
QUF14_RS27615 (78429) 78429..78503 - 75 WP_001364037.1 RepA leader peptide Tap -
QUF14_RS27620 (78747) 78747..78995 - 249 WP_000083838.1 replication regulatory protein RepA -
QUF14_RS27625 (79279) 79279..79428 - 150 WP_001312851.1 Hok/Gef family protein Toxin
- (79476) 79476..79532 + 57 NuclAT_1 - Antitoxin
- (79476) 79476..79532 + 57 NuclAT_1 - Antitoxin
- (79476) 79476..79532 + 57 NuclAT_1 - Antitoxin
- (79476) 79476..79532 + 57 NuclAT_1 - Antitoxin
QUF14_RS27630 (79802) 79802..79960 - 159 Protein_98 hypothetical protein -
QUF14_RS27635 (79998) 79998..80207 - 210 WP_001355319.1 hemolysin expression modulator Hha -
QUF14_RS27640 (80534) 80534..80746 - 213 WP_001364091.1 hypothetical protein -
QUF14_RS27645 (80881) 80881..81441 - 561 WP_040091654.1 fertility inhibition protein FinO -
QUF14_RS27650 (81496) 81496..82233 - 738 WP_047088734.1 conjugal transfer pilus acetylase TraX -
QUF14_RS27655 (82255) 82255..82686 - 432 WP_040091353.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - estIa / estIa / hlyC / hlyA / hlyB / hlyD / exeG / exeE / stcE / faeJ / faeI / faeH / faeF / faeE / faeD / faeC 1..225721 225721


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T40770 WP_001312851.1 NZ_AP025748:c79428-79279 [Escherichia sp. HH091_1A]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

>T40770 NZ_AP025748:c79428-79279 [Escherichia sp. HH091_1A]
ATGACGAAATATGCCCTTATCGGGTTGCTCGCTGTGTGCGCTACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGAGGAAATACAGTGGTGCAGGTAACTTTGGCCTACGAAGCACGGAAGTAA

Antitoxin


Download         Length: 57 bp

>AT40770 NZ_AP025748:79476-79532 [Escherichia sp. HH091_1A]
GTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATCTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References