Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-istR/Ldr(toxin)
Location 1535924..1536145 Replicon chromosome
Accession NZ_AP025747
Organism Escherichia sp. HH091_1A strain HH-P024

Toxin (Protein)


Gene name ldrD Uniprot ID L4JC91
Locus tag QUF14_RS07565 Protein ID WP_000170956.1
Coordinates 1535924..1536031 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name istR
Locus tag -
Coordinates 1536084..1536145 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QUF14_RS07535 (1531234) 1531234..1532316 + 1083 WP_000804726.1 peptide chain release factor 1 -
QUF14_RS07540 (1532316) 1532316..1533149 + 834 WP_000456456.1 peptide chain release factor N(5)-glutamine methyltransferase -
QUF14_RS07545 (1533146) 1533146..1533538 + 393 WP_000200378.1 invasion regulator SirB2 -
QUF14_RS07550 (1533542) 1533542..1534351 + 810 WP_001257058.1 invasion regulator SirB1 -
QUF14_RS07555 (1534387) 1534387..1535241 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
QUF14_RS07560 (1535389) 1535389..1535496 - 108 WP_100733948.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1535544) 1535544..1535609 + 66 NuclAT_11 - -
- (1535544) 1535544..1535609 + 66 NuclAT_11 - -
- (1535544) 1535544..1535609 + 66 NuclAT_11 - -
- (1535544) 1535544..1535609 + 66 NuclAT_11 - -
- (1535544) 1535544..1535609 + 66 NuclAT_13 - -
- (1535544) 1535544..1535609 + 66 NuclAT_13 - -
- (1535544) 1535544..1535609 + 66 NuclAT_13 - -
- (1535544) 1535544..1535609 + 66 NuclAT_13 - -
- (1535544) 1535544..1535609 + 66 NuclAT_15 - -
- (1535544) 1535544..1535609 + 66 NuclAT_15 - -
- (1535544) 1535544..1535609 + 66 NuclAT_15 - -
- (1535544) 1535544..1535609 + 66 NuclAT_15 - -
- (1535544) 1535544..1535609 + 66 NuclAT_17 - -
- (1535544) 1535544..1535609 + 66 NuclAT_17 - -
- (1535544) 1535544..1535609 + 66 NuclAT_17 - -
- (1535544) 1535544..1535609 + 66 NuclAT_17 - -
- (1535544) 1535544..1535609 + 66 NuclAT_19 - -
- (1535544) 1535544..1535609 + 66 NuclAT_19 - -
- (1535544) 1535544..1535609 + 66 NuclAT_19 - -
- (1535544) 1535544..1535609 + 66 NuclAT_19 - -
- (1535544) 1535544..1535609 + 66 NuclAT_21 - -
- (1535544) 1535544..1535609 + 66 NuclAT_21 - -
- (1535544) 1535544..1535609 + 66 NuclAT_21 - -
- (1535544) 1535544..1535609 + 66 NuclAT_21 - -
- (1535545) 1535545..1535610 + 66 NuclAT_27 - -
- (1535545) 1535545..1535610 + 66 NuclAT_27 - -
- (1535545) 1535545..1535610 + 66 NuclAT_27 - -
- (1535545) 1535545..1535610 + 66 NuclAT_27 - -
- (1535545) 1535545..1535610 + 66 NuclAT_31 - -
- (1535545) 1535545..1535610 + 66 NuclAT_31 - -
- (1535545) 1535545..1535610 + 66 NuclAT_31 - -
- (1535545) 1535545..1535610 + 66 NuclAT_31 - -
- (1535545) 1535545..1535610 + 66 NuclAT_35 - -
- (1535545) 1535545..1535610 + 66 NuclAT_35 - -
- (1535545) 1535545..1535610 + 66 NuclAT_35 - -
- (1535545) 1535545..1535610 + 66 NuclAT_35 - -
- (1535545) 1535545..1535610 + 66 NuclAT_39 - -
- (1535545) 1535545..1535610 + 66 NuclAT_39 - -
- (1535545) 1535545..1535610 + 66 NuclAT_39 - -
- (1535545) 1535545..1535610 + 66 NuclAT_39 - -
- (1535544) 1535544..1535611 + 68 NuclAT_25 - -
- (1535544) 1535544..1535611 + 68 NuclAT_25 - -
- (1535544) 1535544..1535611 + 68 NuclAT_25 - -
- (1535544) 1535544..1535611 + 68 NuclAT_25 - -
- (1535544) 1535544..1535611 + 68 NuclAT_29 - -
- (1535544) 1535544..1535611 + 68 NuclAT_29 - -
- (1535544) 1535544..1535611 + 68 NuclAT_29 - -
- (1535544) 1535544..1535611 + 68 NuclAT_29 - -
- (1535544) 1535544..1535611 + 68 NuclAT_33 - -
- (1535544) 1535544..1535611 + 68 NuclAT_33 - -
- (1535544) 1535544..1535611 + 68 NuclAT_33 - -
- (1535544) 1535544..1535611 + 68 NuclAT_33 - -
- (1535544) 1535544..1535611 + 68 NuclAT_37 - -
- (1535544) 1535544..1535611 + 68 NuclAT_37 - -
- (1535544) 1535544..1535611 + 68 NuclAT_37 - -
- (1535544) 1535544..1535611 + 68 NuclAT_37 - -
- (1535544) 1535544..1535611 + 68 NuclAT_41 - -
- (1535544) 1535544..1535611 + 68 NuclAT_41 - -
- (1535544) 1535544..1535611 + 68 NuclAT_41 - -
- (1535544) 1535544..1535611 + 68 NuclAT_41 - -
QUF14_RS07565 (1535924) 1535924..1536031 - 108 WP_000170956.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (1536084) 1536084..1536145 + 62 NuclAT_12 - Antitoxin
- (1536084) 1536084..1536145 + 62 NuclAT_12 - Antitoxin
- (1536084) 1536084..1536145 + 62 NuclAT_12 - Antitoxin
- (1536084) 1536084..1536145 + 62 NuclAT_12 - Antitoxin
- (1536084) 1536084..1536145 + 62 NuclAT_14 - Antitoxin
- (1536084) 1536084..1536145 + 62 NuclAT_14 - Antitoxin
- (1536084) 1536084..1536145 + 62 NuclAT_14 - Antitoxin
- (1536084) 1536084..1536145 + 62 NuclAT_14 - Antitoxin
- (1536084) 1536084..1536145 + 62 NuclAT_16 - Antitoxin
- (1536084) 1536084..1536145 + 62 NuclAT_16 - Antitoxin
- (1536084) 1536084..1536145 + 62 NuclAT_16 - Antitoxin
- (1536084) 1536084..1536145 + 62 NuclAT_16 - Antitoxin
- (1536084) 1536084..1536145 + 62 NuclAT_18 - Antitoxin
- (1536084) 1536084..1536145 + 62 NuclAT_18 - Antitoxin
- (1536084) 1536084..1536145 + 62 NuclAT_18 - Antitoxin
- (1536084) 1536084..1536145 + 62 NuclAT_18 - Antitoxin
- (1536084) 1536084..1536145 + 62 NuclAT_20 - Antitoxin
- (1536084) 1536084..1536145 + 62 NuclAT_20 - Antitoxin
- (1536084) 1536084..1536145 + 62 NuclAT_20 - Antitoxin
- (1536084) 1536084..1536145 + 62 NuclAT_20 - Antitoxin
- (1536084) 1536084..1536145 + 62 NuclAT_22 - Antitoxin
- (1536084) 1536084..1536145 + 62 NuclAT_22 - Antitoxin
- (1536084) 1536084..1536145 + 62 NuclAT_22 - Antitoxin
- (1536084) 1536084..1536145 + 62 NuclAT_22 - Antitoxin
- (1536084) 1536084..1536146 + 63 NuclAT_28 - -
- (1536084) 1536084..1536146 + 63 NuclAT_28 - -
- (1536084) 1536084..1536146 + 63 NuclAT_28 - -
- (1536084) 1536084..1536146 + 63 NuclAT_28 - -
- (1536084) 1536084..1536146 + 63 NuclAT_32 - -
- (1536084) 1536084..1536146 + 63 NuclAT_32 - -
- (1536084) 1536084..1536146 + 63 NuclAT_32 - -
- (1536084) 1536084..1536146 + 63 NuclAT_32 - -
- (1536084) 1536084..1536146 + 63 NuclAT_36 - -
- (1536084) 1536084..1536146 + 63 NuclAT_36 - -
- (1536084) 1536084..1536146 + 63 NuclAT_36 - -
- (1536084) 1536084..1536146 + 63 NuclAT_36 - -
- (1536084) 1536084..1536146 + 63 NuclAT_40 - -
- (1536084) 1536084..1536146 + 63 NuclAT_40 - -
- (1536084) 1536084..1536146 + 63 NuclAT_40 - -
- (1536084) 1536084..1536146 + 63 NuclAT_40 - -
- (1536084) 1536084..1536147 + 64 NuclAT_26 - -
- (1536084) 1536084..1536147 + 64 NuclAT_26 - -
- (1536084) 1536084..1536147 + 64 NuclAT_26 - -
- (1536084) 1536084..1536147 + 64 NuclAT_26 - -
- (1536084) 1536084..1536147 + 64 NuclAT_30 - -
- (1536084) 1536084..1536147 + 64 NuclAT_30 - -
- (1536084) 1536084..1536147 + 64 NuclAT_30 - -
- (1536084) 1536084..1536147 + 64 NuclAT_30 - -
- (1536084) 1536084..1536147 + 64 NuclAT_34 - -
- (1536084) 1536084..1536147 + 64 NuclAT_34 - -
- (1536084) 1536084..1536147 + 64 NuclAT_34 - -
- (1536084) 1536084..1536147 + 64 NuclAT_34 - -
- (1536084) 1536084..1536147 + 64 NuclAT_38 - -
- (1536084) 1536084..1536147 + 64 NuclAT_38 - -
- (1536084) 1536084..1536147 + 64 NuclAT_38 - -
- (1536084) 1536084..1536147 + 64 NuclAT_38 - -
- (1536084) 1536084..1536147 + 64 NuclAT_42 - -
- (1536084) 1536084..1536147 + 64 NuclAT_42 - -
- (1536084) 1536084..1536147 + 64 NuclAT_42 - -
- (1536084) 1536084..1536147 + 64 NuclAT_42 - -
QUF14_RS07570 (1536437) 1536437..1537537 - 1101 WP_001306585.1 sodium-potassium/proton antiporter ChaA -
QUF14_RS07575 (1537807) 1537807..1538037 + 231 WP_001146444.1 putative cation transport regulator ChaB -
QUF14_RS07580 (1538194) 1538194..1538889 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
QUF14_RS07585 (1538933) 1538933..1539286 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
QUF14_RS07590 (1539472) 1539472..1540866 + 1395 WP_024212040.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4041.88 Da        Isoelectric Point: 11.4779

>T40744 WP_000170956.1 NZ_AP025747:c1536031-1535924 [Escherichia sp. HH091_1A]
MTLAQFAMIFWHDLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp

>T40744 NZ_AP025747:c1536031-1535924 [Escherichia sp. HH091_1A]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGTGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 62 bp

>AT40744 NZ_AP025747:1536084-1536145 [Escherichia sp. HH091_1A]
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G035

Antitoxin

Download structure file

References