Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-ohsC/Ldr(toxin)
Location 1623834..1624055 Replicon chromosome
Accession NZ_AP025741
Organism Escherichia sp. 10290

Toxin (Protein)


Gene name ldrD Uniprot ID L4JC91
Locus tag QUE74_RS08100 Protein ID WP_000170956.1
Coordinates 1623834..1623941 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name ohsC
Locus tag -
Coordinates 1623994..1624055 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QUE74_RS08070 (1619144) 1619144..1620226 + 1083 WP_000804741.1 peptide chain release factor 1 -
QUE74_RS08075 (1620226) 1620226..1621059 + 834 WP_000456452.1 peptide chain release factor N(5)-glutamine methyltransferase -
QUE74_RS08080 (1621056) 1621056..1621448 + 393 WP_000200378.1 invasion regulator SirB2 -
QUE74_RS08085 (1621452) 1621452..1622261 + 810 WP_001257059.1 invasion regulator SirB1 -
QUE74_RS08090 (1622297) 1622297..1623151 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
QUE74_RS08095 (1623299) 1623299..1623406 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1623454) 1623454..1623519 + 66 NuclAT_12 - -
- (1623454) 1623454..1623519 + 66 NuclAT_12 - -
- (1623454) 1623454..1623519 + 66 NuclAT_12 - -
- (1623454) 1623454..1623519 + 66 NuclAT_12 - -
- (1623454) 1623454..1623519 + 66 NuclAT_14 - -
- (1623454) 1623454..1623519 + 66 NuclAT_14 - -
- (1623454) 1623454..1623519 + 66 NuclAT_14 - -
- (1623454) 1623454..1623519 + 66 NuclAT_14 - -
- (1623454) 1623454..1623519 + 66 NuclAT_16 - -
- (1623454) 1623454..1623519 + 66 NuclAT_16 - -
- (1623454) 1623454..1623519 + 66 NuclAT_16 - -
- (1623454) 1623454..1623519 + 66 NuclAT_16 - -
- (1623454) 1623454..1623519 + 66 NuclAT_18 - -
- (1623454) 1623454..1623519 + 66 NuclAT_18 - -
- (1623454) 1623454..1623519 + 66 NuclAT_18 - -
- (1623454) 1623454..1623519 + 66 NuclAT_18 - -
- (1623454) 1623454..1623519 + 66 NuclAT_20 - -
- (1623454) 1623454..1623519 + 66 NuclAT_20 - -
- (1623454) 1623454..1623519 + 66 NuclAT_20 - -
- (1623454) 1623454..1623519 + 66 NuclAT_20 - -
- (1623454) 1623454..1623519 + 66 NuclAT_22 - -
- (1623454) 1623454..1623519 + 66 NuclAT_22 - -
- (1623454) 1623454..1623519 + 66 NuclAT_22 - -
- (1623454) 1623454..1623519 + 66 NuclAT_22 - -
- (1623455) 1623455..1623520 + 66 NuclAT_26 - -
- (1623455) 1623455..1623520 + 66 NuclAT_26 - -
- (1623455) 1623455..1623520 + 66 NuclAT_26 - -
- (1623455) 1623455..1623520 + 66 NuclAT_26 - -
- (1623455) 1623455..1623520 + 66 NuclAT_30 - -
- (1623455) 1623455..1623520 + 66 NuclAT_30 - -
- (1623455) 1623455..1623520 + 66 NuclAT_30 - -
- (1623455) 1623455..1623520 + 66 NuclAT_30 - -
- (1623455) 1623455..1623520 + 66 NuclAT_34 - -
- (1623455) 1623455..1623520 + 66 NuclAT_34 - -
- (1623455) 1623455..1623520 + 66 NuclAT_34 - -
- (1623455) 1623455..1623520 + 66 NuclAT_34 - -
- (1623455) 1623455..1623520 + 66 NuclAT_38 - -
- (1623455) 1623455..1623520 + 66 NuclAT_38 - -
- (1623455) 1623455..1623520 + 66 NuclAT_38 - -
- (1623455) 1623455..1623520 + 66 NuclAT_38 - -
- (1623455) 1623455..1623520 + 66 NuclAT_42 - -
- (1623455) 1623455..1623520 + 66 NuclAT_42 - -
- (1623455) 1623455..1623520 + 66 NuclAT_42 - -
- (1623455) 1623455..1623520 + 66 NuclAT_42 - -
- (1623454) 1623454..1623521 + 68 NuclAT_24 - -
- (1623454) 1623454..1623521 + 68 NuclAT_24 - -
- (1623454) 1623454..1623521 + 68 NuclAT_24 - -
- (1623454) 1623454..1623521 + 68 NuclAT_24 - -
- (1623454) 1623454..1623521 + 68 NuclAT_28 - -
- (1623454) 1623454..1623521 + 68 NuclAT_28 - -
- (1623454) 1623454..1623521 + 68 NuclAT_28 - -
- (1623454) 1623454..1623521 + 68 NuclAT_28 - -
- (1623454) 1623454..1623521 + 68 NuclAT_32 - -
- (1623454) 1623454..1623521 + 68 NuclAT_32 - -
- (1623454) 1623454..1623521 + 68 NuclAT_32 - -
- (1623454) 1623454..1623521 + 68 NuclAT_32 - -
- (1623454) 1623454..1623521 + 68 NuclAT_36 - -
- (1623454) 1623454..1623521 + 68 NuclAT_36 - -
- (1623454) 1623454..1623521 + 68 NuclAT_36 - -
- (1623454) 1623454..1623521 + 68 NuclAT_36 - -
- (1623454) 1623454..1623521 + 68 NuclAT_40 - -
- (1623454) 1623454..1623521 + 68 NuclAT_40 - -
- (1623454) 1623454..1623521 + 68 NuclAT_40 - -
- (1623454) 1623454..1623521 + 68 NuclAT_40 - -
QUE74_RS08100 (1623834) 1623834..1623941 - 108 WP_000170956.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (1623994) 1623994..1624055 + 62 NuclAT_13 - Antitoxin
- (1623994) 1623994..1624055 + 62 NuclAT_13 - Antitoxin
- (1623994) 1623994..1624055 + 62 NuclAT_13 - Antitoxin
- (1623994) 1623994..1624055 + 62 NuclAT_13 - Antitoxin
- (1623994) 1623994..1624055 + 62 NuclAT_15 - Antitoxin
- (1623994) 1623994..1624055 + 62 NuclAT_15 - Antitoxin
- (1623994) 1623994..1624055 + 62 NuclAT_15 - Antitoxin
- (1623994) 1623994..1624055 + 62 NuclAT_15 - Antitoxin
- (1623994) 1623994..1624055 + 62 NuclAT_17 - Antitoxin
- (1623994) 1623994..1624055 + 62 NuclAT_17 - Antitoxin
- (1623994) 1623994..1624055 + 62 NuclAT_17 - Antitoxin
- (1623994) 1623994..1624055 + 62 NuclAT_17 - Antitoxin
- (1623994) 1623994..1624055 + 62 NuclAT_19 - Antitoxin
- (1623994) 1623994..1624055 + 62 NuclAT_19 - Antitoxin
- (1623994) 1623994..1624055 + 62 NuclAT_19 - Antitoxin
- (1623994) 1623994..1624055 + 62 NuclAT_19 - Antitoxin
- (1623994) 1623994..1624055 + 62 NuclAT_21 - Antitoxin
- (1623994) 1623994..1624055 + 62 NuclAT_21 - Antitoxin
- (1623994) 1623994..1624055 + 62 NuclAT_21 - Antitoxin
- (1623994) 1623994..1624055 + 62 NuclAT_21 - Antitoxin
- (1623994) 1623994..1624055 + 62 NuclAT_23 - Antitoxin
- (1623994) 1623994..1624055 + 62 NuclAT_23 - Antitoxin
- (1623994) 1623994..1624055 + 62 NuclAT_23 - Antitoxin
- (1623994) 1623994..1624055 + 62 NuclAT_23 - Antitoxin
- (1623994) 1623994..1624056 + 63 NuclAT_27 - -
- (1623994) 1623994..1624056 + 63 NuclAT_27 - -
- (1623994) 1623994..1624056 + 63 NuclAT_27 - -
- (1623994) 1623994..1624056 + 63 NuclAT_27 - -
- (1623994) 1623994..1624056 + 63 NuclAT_31 - -
- (1623994) 1623994..1624056 + 63 NuclAT_31 - -
- (1623994) 1623994..1624056 + 63 NuclAT_31 - -
- (1623994) 1623994..1624056 + 63 NuclAT_31 - -
- (1623994) 1623994..1624056 + 63 NuclAT_35 - -
- (1623994) 1623994..1624056 + 63 NuclAT_35 - -
- (1623994) 1623994..1624056 + 63 NuclAT_35 - -
- (1623994) 1623994..1624056 + 63 NuclAT_35 - -
- (1623994) 1623994..1624056 + 63 NuclAT_39 - -
- (1623994) 1623994..1624056 + 63 NuclAT_39 - -
- (1623994) 1623994..1624056 + 63 NuclAT_39 - -
- (1623994) 1623994..1624056 + 63 NuclAT_39 - -
- (1623994) 1623994..1624056 + 63 NuclAT_43 - -
- (1623994) 1623994..1624056 + 63 NuclAT_43 - -
- (1623994) 1623994..1624056 + 63 NuclAT_43 - -
- (1623994) 1623994..1624056 + 63 NuclAT_43 - -
- (1623994) 1623994..1624057 + 64 NuclAT_25 - -
- (1623994) 1623994..1624057 + 64 NuclAT_25 - -
- (1623994) 1623994..1624057 + 64 NuclAT_25 - -
- (1623994) 1623994..1624057 + 64 NuclAT_25 - -
- (1623994) 1623994..1624057 + 64 NuclAT_29 - -
- (1623994) 1623994..1624057 + 64 NuclAT_29 - -
- (1623994) 1623994..1624057 + 64 NuclAT_29 - -
- (1623994) 1623994..1624057 + 64 NuclAT_29 - -
- (1623994) 1623994..1624057 + 64 NuclAT_33 - -
- (1623994) 1623994..1624057 + 64 NuclAT_33 - -
- (1623994) 1623994..1624057 + 64 NuclAT_33 - -
- (1623994) 1623994..1624057 + 64 NuclAT_33 - -
- (1623994) 1623994..1624057 + 64 NuclAT_37 - -
- (1623994) 1623994..1624057 + 64 NuclAT_37 - -
- (1623994) 1623994..1624057 + 64 NuclAT_37 - -
- (1623994) 1623994..1624057 + 64 NuclAT_37 - -
- (1623994) 1623994..1624057 + 64 NuclAT_41 - -
- (1623994) 1623994..1624057 + 64 NuclAT_41 - -
- (1623994) 1623994..1624057 + 64 NuclAT_41 - -
- (1623994) 1623994..1624057 + 64 NuclAT_41 - -
QUE74_RS08105 (1624347) 1624347..1625447 - 1101 WP_001306585.1 sodium-potassium/proton antiporter ChaA -
QUE74_RS08110 (1625717) 1625717..1625947 + 231 WP_001146444.1 putative cation transport regulator ChaB -
QUE74_RS08115 (1626104) 1626104..1626799 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
QUE74_RS08120 (1626843) 1626843..1627196 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
QUE74_RS08125 (1627382) 1627382..1628776 + 1395 WP_024166161.1 inverse autotransporter invasin YchO -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 4041.88 Da        Isoelectric Point: 11.4779

>T40701 WP_000170956.1 NZ_AP025741:c1623941-1623834 [Escherichia sp. 10290]
MTLAQFAMIFWHDLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp

>T40701 NZ_AP025741:c1623941-1623834 [Escherichia sp. 10290]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTAGCGGCACCGATCCTGGCGGGGATTATTACCGCAGTGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 62 bp

>AT40701 NZ_AP025741:1623994-1624055 [Escherichia sp. 10290]
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A829G035


Antitoxin

Download structure file

References