Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 1623299..1623519 | Replicon | chromosome |
| Accession | NZ_AP025741 | ||
| Organism | Escherichia sp. 10290 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | B7LGX8 |
| Locus tag | QUE74_RS08095 | Protein ID | WP_000170965.1 |
| Coordinates | 1623299..1623406 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 1623453..1623519 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QUE74_RS08070 | 1619144..1620226 | + | 1083 | WP_000804741.1 | peptide chain release factor 1 | - |
| QUE74_RS08075 | 1620226..1621059 | + | 834 | WP_000456452.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| QUE74_RS08080 | 1621056..1621448 | + | 393 | WP_000200378.1 | invasion regulator SirB2 | - |
| QUE74_RS08085 | 1621452..1622261 | + | 810 | WP_001257059.1 | invasion regulator SirB1 | - |
| QUE74_RS08090 | 1622297..1623151 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| QUE74_RS08095 | 1623299..1623406 | - | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 1623453..1623519 | + | 67 | - | - | Antitoxin |
| QUE74_RS08100 | 1623834..1623941 | - | 108 | WP_000170956.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 1623994..1624055 | + | 62 | NuclAT_13 | - | - |
| - | 1623994..1624055 | + | 62 | NuclAT_13 | - | - |
| - | 1623994..1624055 | + | 62 | NuclAT_13 | - | - |
| - | 1623994..1624055 | + | 62 | NuclAT_13 | - | - |
| - | 1623994..1624055 | + | 62 | NuclAT_15 | - | - |
| - | 1623994..1624055 | + | 62 | NuclAT_15 | - | - |
| - | 1623994..1624055 | + | 62 | NuclAT_15 | - | - |
| - | 1623994..1624055 | + | 62 | NuclAT_15 | - | - |
| - | 1623994..1624055 | + | 62 | NuclAT_17 | - | - |
| - | 1623994..1624055 | + | 62 | NuclAT_17 | - | - |
| - | 1623994..1624055 | + | 62 | NuclAT_17 | - | - |
| - | 1623994..1624055 | + | 62 | NuclAT_17 | - | - |
| - | 1623994..1624055 | + | 62 | NuclAT_19 | - | - |
| - | 1623994..1624055 | + | 62 | NuclAT_19 | - | - |
| - | 1623994..1624055 | + | 62 | NuclAT_19 | - | - |
| - | 1623994..1624055 | + | 62 | NuclAT_19 | - | - |
| - | 1623994..1624055 | + | 62 | NuclAT_21 | - | - |
| - | 1623994..1624055 | + | 62 | NuclAT_21 | - | - |
| - | 1623994..1624055 | + | 62 | NuclAT_21 | - | - |
| - | 1623994..1624055 | + | 62 | NuclAT_21 | - | - |
| - | 1623994..1624055 | + | 62 | NuclAT_23 | - | - |
| - | 1623994..1624055 | + | 62 | NuclAT_23 | - | - |
| - | 1623994..1624055 | + | 62 | NuclAT_23 | - | - |
| - | 1623994..1624055 | + | 62 | NuclAT_23 | - | - |
| - | 1623994..1624056 | + | 63 | NuclAT_27 | - | - |
| - | 1623994..1624056 | + | 63 | NuclAT_27 | - | - |
| - | 1623994..1624056 | + | 63 | NuclAT_27 | - | - |
| - | 1623994..1624056 | + | 63 | NuclAT_27 | - | - |
| - | 1623994..1624056 | + | 63 | NuclAT_31 | - | - |
| - | 1623994..1624056 | + | 63 | NuclAT_31 | - | - |
| - | 1623994..1624056 | + | 63 | NuclAT_31 | - | - |
| - | 1623994..1624056 | + | 63 | NuclAT_31 | - | - |
| - | 1623994..1624056 | + | 63 | NuclAT_35 | - | - |
| - | 1623994..1624056 | + | 63 | NuclAT_35 | - | - |
| - | 1623994..1624056 | + | 63 | NuclAT_35 | - | - |
| - | 1623994..1624056 | + | 63 | NuclAT_35 | - | - |
| - | 1623994..1624056 | + | 63 | NuclAT_39 | - | - |
| - | 1623994..1624056 | + | 63 | NuclAT_39 | - | - |
| - | 1623994..1624056 | + | 63 | NuclAT_39 | - | - |
| - | 1623994..1624056 | + | 63 | NuclAT_39 | - | - |
| - | 1623994..1624056 | + | 63 | NuclAT_43 | - | - |
| - | 1623994..1624056 | + | 63 | NuclAT_43 | - | - |
| - | 1623994..1624056 | + | 63 | NuclAT_43 | - | - |
| - | 1623994..1624056 | + | 63 | NuclAT_43 | - | - |
| - | 1623994..1624057 | + | 64 | NuclAT_25 | - | - |
| - | 1623994..1624057 | + | 64 | NuclAT_25 | - | - |
| - | 1623994..1624057 | + | 64 | NuclAT_25 | - | - |
| - | 1623994..1624057 | + | 64 | NuclAT_25 | - | - |
| - | 1623994..1624057 | + | 64 | NuclAT_29 | - | - |
| - | 1623994..1624057 | + | 64 | NuclAT_29 | - | - |
| - | 1623994..1624057 | + | 64 | NuclAT_29 | - | - |
| - | 1623994..1624057 | + | 64 | NuclAT_29 | - | - |
| - | 1623994..1624057 | + | 64 | NuclAT_33 | - | - |
| - | 1623994..1624057 | + | 64 | NuclAT_33 | - | - |
| - | 1623994..1624057 | + | 64 | NuclAT_33 | - | - |
| - | 1623994..1624057 | + | 64 | NuclAT_33 | - | - |
| - | 1623994..1624057 | + | 64 | NuclAT_37 | - | - |
| - | 1623994..1624057 | + | 64 | NuclAT_37 | - | - |
| - | 1623994..1624057 | + | 64 | NuclAT_37 | - | - |
| - | 1623994..1624057 | + | 64 | NuclAT_37 | - | - |
| - | 1623994..1624057 | + | 64 | NuclAT_41 | - | - |
| - | 1623994..1624057 | + | 64 | NuclAT_41 | - | - |
| - | 1623994..1624057 | + | 64 | NuclAT_41 | - | - |
| - | 1623994..1624057 | + | 64 | NuclAT_41 | - | - |
| QUE74_RS08105 | 1624347..1625447 | - | 1101 | WP_001306585.1 | sodium-potassium/proton antiporter ChaA | - |
| QUE74_RS08110 | 1625717..1625947 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
| QUE74_RS08115 | 1626104..1626799 | + | 696 | WP_001295621.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| QUE74_RS08120 | 1626843..1627196 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4001.77 Da Isoelectric Point: 11.4779
>T40699 WP_000170965.1 NZ_AP025741:c1623406-1623299 [Escherichia sp. 10290]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T40699 NZ_AP025741:c1623406-1623299 [Escherichia sp. 10290]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT40699 NZ_AP025741:1623453-1623519 [Escherichia sp. 10290]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|