Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2270116..2270333 | Replicon | chromosome |
Accession | NZ_AP025693 | ||
Organism | Staphylococcus aureus strain JICS127 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | M2038_RS11385 | Protein ID | WP_001802298.1 |
Coordinates | 2270229..2270333 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF4 | ||
Locus tag | - | ||
Coordinates | 2270116..2270171 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2038_RS11360 | 2266253..2266918 | - | 666 | WP_001024094.1 | SDR family oxidoreductase | - |
M2038_RS11365 | 2267070..2267390 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
M2038_RS11370 | 2267392..2268372 | + | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
M2038_RS11375 | 2268638..2269729 | + | 1092 | WP_000495671.1 | lytic regulatory protein | - |
- | 2270116..2270171 | + | 56 | - | - | Antitoxin |
M2038_RS11385 | 2270229..2270333 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
M2038_RS11390 | 2270494..2270977 | - | 484 | Protein_2210 | recombinase family protein | - |
M2038_RS11395 | 2271020..2272156 | - | 1137 | WP_000115564.1 | SAP domain-containing protein | - |
M2038_RS11400 | 2272445..2272537 | + | 93 | WP_001790138.1 | hypothetical protein | - |
M2038_RS11410 | 2273242..2274099 | - | 858 | WP_000370924.1 | HAD family hydrolase | - |
M2038_RS11415 | 2274167..2274949 | - | 783 | WP_000908176.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T40664 WP_001802298.1 NZ_AP025693:c2270333-2270229 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T40664 NZ_AP025693:c2270333-2270229 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTTATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTTATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT40664 NZ_AP025693:2270116-2270171 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|