Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1934521..1934703 | Replicon | chromosome |
| Accession | NZ_AP025693 | ||
| Organism | Staphylococcus aureus strain JICS127 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | M2038_RS09410 | Protein ID | WP_001801861.1 |
| Coordinates | 1934521..1934616 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1934644..1934703 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2038_RS09370 | 1930181..1930807 | + | 627 | Protein_1848 | hypothetical protein | - |
| M2038_RS09375 | 1930848..1931192 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
| M2038_RS09380 | 1931290..1931841 | + | 552 | WP_000414205.1 | hypothetical protein | - |
| M2038_RS09385 | 1932059..1932700 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
| M2038_RS09390 | 1932814..1932999 | - | 186 | WP_000809857.1 | hypothetical protein | - |
| M2038_RS09395 | 1933001..1933177 | - | 177 | WP_000375476.1 | hypothetical protein | - |
| M2038_RS09400 | 1933188..1933571 | - | 384 | WP_000070811.1 | hypothetical protein | - |
| M2038_RS09405 | 1934175..1934318 | - | 144 | WP_001549059.1 | transposase | - |
| M2038_RS09410 | 1934521..1934616 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1934644..1934703 | - | 60 | - | - | Antitoxin |
| M2038_RS09415 | 1934739..1934840 | + | 102 | WP_001791893.1 | hypothetical protein | - |
| M2038_RS09420 | 1934818..1934994 | - | 177 | Protein_1858 | transposase | - |
| M2038_RS09425 | 1935188..1935565 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | lukD / hlgA | 1908495..1967791 | 59296 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T40655 WP_001801861.1 NZ_AP025693:1934521-1934616 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T40655 NZ_AP025693:1934521-1934616 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT40655 NZ_AP025693:c1934703-1934644 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|