Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2482694..2482878 | Replicon | chromosome |
Accession | NZ_AP025683 | ||
Organism | Staphylococcus aureus strain JP025 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | SAJP025_RS12280 | Protein ID | WP_000482647.1 |
Coordinates | 2482771..2482878 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2482694..2482754 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAJP025_RS12265 | 2478204..2478371 | - | 168 | Protein_2375 | hypothetical protein | - |
SAJP025_RS12270 | 2478602..2480335 | - | 1734 | WP_000486505.1 | ABC transporter ATP-binding protein | - |
SAJP025_RS12275 | 2480360..2482123 | - | 1764 | WP_001064829.1 | ABC transporter ATP-binding protein | - |
- | 2482694..2482754 | + | 61 | - | - | Antitoxin |
SAJP025_RS12280 | 2482771..2482878 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
SAJP025_RS12285 | 2483012..2483398 | - | 387 | WP_000779351.1 | flippase GtxA | - |
SAJP025_RS12290 | 2483666..2484808 | + | 1143 | WP_001176856.1 | glycerate kinase | - |
SAJP025_RS12295 | 2484868..2485527 | + | 660 | WP_000831298.1 | membrane protein | - |
SAJP025_RS12300 | 2485709..2486920 | + | 1212 | WP_001191920.1 | multidrug effflux MFS transporter | - |
SAJP025_RS12305 | 2487043..2487516 | - | 474 | WP_000456496.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T40645 WP_000482647.1 NZ_AP025683:c2482878-2482771 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T40645 NZ_AP025683:c2482878-2482771 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT40645 NZ_AP025683:2482694-2482754 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|