Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2197600..2197816 | Replicon | chromosome |
Accession | NZ_AP025683 | ||
Organism | Staphylococcus aureus strain JP025 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | - |
Locus tag | SAJP025_RS10785 | Protein ID | WP_073392962.1 |
Coordinates | 2197712..2197816 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 2197600..2197655 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAJP025_RS10760 | 2193794..2194459 | - | 666 | WP_248535966.1 | SDR family oxidoreductase | - |
SAJP025_RS10765 | 2194611..2194931 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
SAJP025_RS10770 | 2194933..2195913 | + | 981 | WP_000019741.1 | CDF family zinc efflux transporter CzrB | - |
SAJP025_RS10775 | 2196179..2197270 | + | 1092 | WP_029264569.1 | hypothetical protein | - |
- | 2197600..2197655 | + | 56 | - | - | Antitoxin |
SAJP025_RS10785 | 2197712..2197816 | - | 105 | WP_073392962.1 | hypothetical protein | Toxin |
SAJP025_RS10790 | 2198496..2198654 | + | 159 | WP_078091561.1 | integrase | - |
SAJP025_RS10795 | 2199313..2200170 | - | 858 | WP_000370937.1 | HAD family hydrolase | - |
SAJP025_RS10800 | 2200238..2201020 | - | 783 | WP_000908186.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3920.80 Da Isoelectric Point: 5.5724
>T40641 WP_073392962.1 NZ_AP025683:c2197816-2197712 [Staphylococcus aureus]
MLLLERTSMSDFEMLMIVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMIVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T40641 NZ_AP025683:c2197816-2197712 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGATTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGATTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT40641 NZ_AP025683:2197600-2197655 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|