Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1890744..1890924 | Replicon | chromosome |
Accession | NZ_AP025683 | ||
Organism | Staphylococcus aureus strain JP025 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | SAJP025_RS09065 | Protein ID | WP_001801861.1 |
Coordinates | 1890744..1890839 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1890867..1890924 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAJP025_RS09035 | 1885888..1886514 | + | 627 | WP_000669038.1 | hypothetical protein | - |
SAJP025_RS09040 | 1886555..1886899 | + | 345 | WP_000627550.1 | DUF3969 family protein | - |
SAJP025_RS09045 | 1886997..1887569 | + | 573 | WP_000414222.1 | hypothetical protein | - |
SAJP025_RS09050 | 1887718..1889085 | - | 1368 | WP_001093573.1 | FRG domain-containing protein | - |
SAJP025_RS09055 | 1889085..1889654 | - | 570 | WP_000125075.1 | ImmA/IrrE family metallo-endopeptidase | - |
SAJP025_RS09060 | 1889847..1890293 | - | 447 | WP_000747804.1 | DUF1433 domain-containing protein | - |
SAJP025_RS09065 | 1890744..1890839 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1890867..1890924 | - | 58 | - | - | Antitoxin |
SAJP025_RS09070 | 1890962..1891063 | + | 102 | WP_001791232.1 | hypothetical protein | - |
SAJP025_RS09075 | 1891238..1891681 | - | 444 | WP_001037039.1 | DUF1433 domain-containing protein | - |
SAJP025_RS09080 | 1891681..1892124 | - | 444 | WP_000731421.1 | DUF1433 domain-containing protein | - |
SAJP025_RS09085 | 1892124..1892566 | - | 443 | Protein_1790 | DUF1433 domain-containing protein | - |
SAJP025_RS09090 | 1893091..1895511 | + | 2421 | WP_000182551.1 | polysaccharide lyase 8 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T40633 WP_001801861.1 NZ_AP025683:1890744-1890839 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T40633 NZ_AP025683:1890744-1890839 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT40633 NZ_AP025683:c1890924-1890867 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|