Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 188593..188815 | Replicon | chromosome |
| Accession | NZ_AP025675 | ||
| Organism | Escherichia coli strain Rb-3 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1NWX0 |
| Locus tag | MWM15_RS00890 | Protein ID | WP_001295224.1 |
| Coordinates | 188708..188815 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 188593..188659 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MWM15_RS00870 | 184034..184936 | + | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
| MWM15_RS00875 | 184947..185930 | + | 984 | WP_001196477.1 | dipeptide ABC transporter ATP-binding protein | - |
| MWM15_RS00880 | 185927..186931 | + | 1005 | WP_000103577.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| MWM15_RS00885 | 186961..188232 | - | 1272 | WP_001298005.1 | aromatic amino acid transport family protein | - |
| - | 188593..188659 | - | 67 | - | - | Antitoxin |
| MWM15_RS00890 | 188708..188815 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| MWM15_RS00895 | 188902..190581 | - | 1680 | WP_000191565.1 | cellulose biosynthesis protein BcsG | - |
| MWM15_RS00900 | 190578..190769 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| MWM15_RS00905 | 190766..192337 | - | 1572 | WP_001204945.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
| MWM15_RS00910 | 192610..192798 | + | 189 | WP_001063314.1 | cellulose biosynthesis protein BcsR | - |
| MWM15_RS00915 | 192810..193562 | + | 753 | WP_000279536.1 | cellulose biosynthesis protein BcsQ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T40541 WP_001295224.1 NZ_AP025675:188708-188815 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T40541 NZ_AP025675:188708-188815 [Escherichia coli]
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT40541 NZ_AP025675:c188659-188593 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGATATTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGGTTCAAGATTAGCCCCCGTGATATTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|