Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 3153958..3154179 Replicon chromosome
Accession NZ_AP025657
Organism Escherichia coli strain TUM13867

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag MWM17_RS15240 Protein ID WP_000170965.1
Coordinates 3153958..3154065 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 3154113..3154179 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MWM17_RS15215 (3149803) 3149803..3150885 + 1083 WP_000804726.1 peptide chain release factor 1 -
MWM17_RS15220 (3150885) 3150885..3151718 + 834 WP_000456458.1 peptide chain release factor N(5)-glutamine methyltransferase -
MWM17_RS15225 (3151715) 3151715..3152107 + 393 WP_000151883.1 invasion regulator SirB2 -
MWM17_RS15230 (3152111) 3152111..3152920 + 810 WP_001257044.1 invasion regulator SirB1 -
MWM17_RS15235 (3152956) 3152956..3153810 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
MWM17_RS15240 (3153958) 3153958..3154065 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (3154115) 3154115..3154178 + 64 NuclAT_26 - -
- (3154115) 3154115..3154178 + 64 NuclAT_26 - -
- (3154115) 3154115..3154178 + 64 NuclAT_26 - -
- (3154115) 3154115..3154178 + 64 NuclAT_26 - -
- (3154115) 3154115..3154178 + 64 NuclAT_28 - -
- (3154115) 3154115..3154178 + 64 NuclAT_28 - -
- (3154115) 3154115..3154178 + 64 NuclAT_28 - -
- (3154115) 3154115..3154178 + 64 NuclAT_28 - -
- (3154115) 3154115..3154178 + 64 NuclAT_30 - -
- (3154115) 3154115..3154178 + 64 NuclAT_30 - -
- (3154115) 3154115..3154178 + 64 NuclAT_30 - -
- (3154115) 3154115..3154178 + 64 NuclAT_30 - -
- (3154115) 3154115..3154178 + 64 NuclAT_32 - -
- (3154115) 3154115..3154178 + 64 NuclAT_32 - -
- (3154115) 3154115..3154178 + 64 NuclAT_32 - -
- (3154115) 3154115..3154178 + 64 NuclAT_32 - -
- (3154115) 3154115..3154178 + 64 NuclAT_34 - -
- (3154115) 3154115..3154178 + 64 NuclAT_34 - -
- (3154115) 3154115..3154178 + 64 NuclAT_34 - -
- (3154115) 3154115..3154178 + 64 NuclAT_34 - -
- (3154115) 3154115..3154178 + 64 NuclAT_36 - -
- (3154115) 3154115..3154178 + 64 NuclAT_36 - -
- (3154115) 3154115..3154178 + 64 NuclAT_36 - -
- (3154115) 3154115..3154178 + 64 NuclAT_36 - -
- (3154113) 3154113..3154179 + 67 NuclAT_13 - Antitoxin
- (3154113) 3154113..3154179 + 67 NuclAT_13 - Antitoxin
- (3154113) 3154113..3154179 + 67 NuclAT_13 - Antitoxin
- (3154113) 3154113..3154179 + 67 NuclAT_13 - Antitoxin
- (3154113) 3154113..3154179 + 67 NuclAT_15 - Antitoxin
- (3154113) 3154113..3154179 + 67 NuclAT_15 - Antitoxin
- (3154113) 3154113..3154179 + 67 NuclAT_15 - Antitoxin
- (3154113) 3154113..3154179 + 67 NuclAT_15 - Antitoxin
- (3154113) 3154113..3154179 + 67 NuclAT_17 - Antitoxin
- (3154113) 3154113..3154179 + 67 NuclAT_17 - Antitoxin
- (3154113) 3154113..3154179 + 67 NuclAT_17 - Antitoxin
- (3154113) 3154113..3154179 + 67 NuclAT_17 - Antitoxin
- (3154113) 3154113..3154179 + 67 NuclAT_19 - Antitoxin
- (3154113) 3154113..3154179 + 67 NuclAT_19 - Antitoxin
- (3154113) 3154113..3154179 + 67 NuclAT_19 - Antitoxin
- (3154113) 3154113..3154179 + 67 NuclAT_19 - Antitoxin
- (3154113) 3154113..3154179 + 67 NuclAT_21 - Antitoxin
- (3154113) 3154113..3154179 + 67 NuclAT_21 - Antitoxin
- (3154113) 3154113..3154179 + 67 NuclAT_21 - Antitoxin
- (3154113) 3154113..3154179 + 67 NuclAT_21 - Antitoxin
- (3154113) 3154113..3154179 + 67 NuclAT_23 - Antitoxin
- (3154113) 3154113..3154179 + 67 NuclAT_23 - Antitoxin
- (3154113) 3154113..3154179 + 67 NuclAT_23 - Antitoxin
- (3154113) 3154113..3154179 + 67 NuclAT_23 - Antitoxin
- (3154115) 3154115..3154180 + 66 NuclAT_38 - -
- (3154115) 3154115..3154180 + 66 NuclAT_38 - -
- (3154115) 3154115..3154180 + 66 NuclAT_38 - -
- (3154115) 3154115..3154180 + 66 NuclAT_38 - -
- (3154115) 3154115..3154180 + 66 NuclAT_40 - -
- (3154115) 3154115..3154180 + 66 NuclAT_40 - -
- (3154115) 3154115..3154180 + 66 NuclAT_40 - -
- (3154115) 3154115..3154180 + 66 NuclAT_40 - -
- (3154115) 3154115..3154180 + 66 NuclAT_42 - -
- (3154115) 3154115..3154180 + 66 NuclAT_42 - -
- (3154115) 3154115..3154180 + 66 NuclAT_42 - -
- (3154115) 3154115..3154180 + 66 NuclAT_42 - -
- (3154115) 3154115..3154180 + 66 NuclAT_44 - -
- (3154115) 3154115..3154180 + 66 NuclAT_44 - -
- (3154115) 3154115..3154180 + 66 NuclAT_44 - -
- (3154115) 3154115..3154180 + 66 NuclAT_44 - -
MWM17_RS15245 (3154493) 3154493..3154600 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein -
- (3154653) 3154653..3154714 + 62 NuclAT_25 - -
- (3154653) 3154653..3154714 + 62 NuclAT_25 - -
- (3154653) 3154653..3154714 + 62 NuclAT_25 - -
- (3154653) 3154653..3154714 + 62 NuclAT_25 - -
- (3154653) 3154653..3154714 + 62 NuclAT_27 - -
- (3154653) 3154653..3154714 + 62 NuclAT_27 - -
- (3154653) 3154653..3154714 + 62 NuclAT_27 - -
- (3154653) 3154653..3154714 + 62 NuclAT_27 - -
- (3154653) 3154653..3154714 + 62 NuclAT_29 - -
- (3154653) 3154653..3154714 + 62 NuclAT_29 - -
- (3154653) 3154653..3154714 + 62 NuclAT_29 - -
- (3154653) 3154653..3154714 + 62 NuclAT_29 - -
- (3154653) 3154653..3154714 + 62 NuclAT_31 - -
- (3154653) 3154653..3154714 + 62 NuclAT_31 - -
- (3154653) 3154653..3154714 + 62 NuclAT_31 - -
- (3154653) 3154653..3154714 + 62 NuclAT_31 - -
- (3154653) 3154653..3154714 + 62 NuclAT_33 - -
- (3154653) 3154653..3154714 + 62 NuclAT_33 - -
- (3154653) 3154653..3154714 + 62 NuclAT_33 - -
- (3154653) 3154653..3154714 + 62 NuclAT_33 - -
- (3154653) 3154653..3154714 + 62 NuclAT_35 - -
- (3154653) 3154653..3154714 + 62 NuclAT_35 - -
- (3154653) 3154653..3154714 + 62 NuclAT_35 - -
- (3154653) 3154653..3154714 + 62 NuclAT_35 - -
- (3154653) 3154653..3154715 + 63 NuclAT_14 - -
- (3154653) 3154653..3154715 + 63 NuclAT_14 - -
- (3154653) 3154653..3154715 + 63 NuclAT_14 - -
- (3154653) 3154653..3154715 + 63 NuclAT_14 - -
- (3154653) 3154653..3154715 + 63 NuclAT_16 - -
- (3154653) 3154653..3154715 + 63 NuclAT_16 - -
- (3154653) 3154653..3154715 + 63 NuclAT_16 - -
- (3154653) 3154653..3154715 + 63 NuclAT_16 - -
- (3154653) 3154653..3154715 + 63 NuclAT_18 - -
- (3154653) 3154653..3154715 + 63 NuclAT_18 - -
- (3154653) 3154653..3154715 + 63 NuclAT_18 - -
- (3154653) 3154653..3154715 + 63 NuclAT_18 - -
- (3154653) 3154653..3154715 + 63 NuclAT_20 - -
- (3154653) 3154653..3154715 + 63 NuclAT_20 - -
- (3154653) 3154653..3154715 + 63 NuclAT_20 - -
- (3154653) 3154653..3154715 + 63 NuclAT_20 - -
- (3154653) 3154653..3154715 + 63 NuclAT_22 - -
- (3154653) 3154653..3154715 + 63 NuclAT_22 - -
- (3154653) 3154653..3154715 + 63 NuclAT_22 - -
- (3154653) 3154653..3154715 + 63 NuclAT_22 - -
- (3154653) 3154653..3154715 + 63 NuclAT_24 - -
- (3154653) 3154653..3154715 + 63 NuclAT_24 - -
- (3154653) 3154653..3154715 + 63 NuclAT_24 - -
- (3154653) 3154653..3154715 + 63 NuclAT_24 - -
- (3154653) 3154653..3154716 + 64 NuclAT_37 - -
- (3154653) 3154653..3154716 + 64 NuclAT_37 - -
- (3154653) 3154653..3154716 + 64 NuclAT_37 - -
- (3154653) 3154653..3154716 + 64 NuclAT_37 - -
- (3154653) 3154653..3154716 + 64 NuclAT_39 - -
- (3154653) 3154653..3154716 + 64 NuclAT_39 - -
- (3154653) 3154653..3154716 + 64 NuclAT_39 - -
- (3154653) 3154653..3154716 + 64 NuclAT_39 - -
- (3154653) 3154653..3154716 + 64 NuclAT_41 - -
- (3154653) 3154653..3154716 + 64 NuclAT_41 - -
- (3154653) 3154653..3154716 + 64 NuclAT_41 - -
- (3154653) 3154653..3154716 + 64 NuclAT_41 - -
- (3154653) 3154653..3154716 + 64 NuclAT_43 - -
- (3154653) 3154653..3154716 + 64 NuclAT_43 - -
- (3154653) 3154653..3154716 + 64 NuclAT_43 - -
- (3154653) 3154653..3154716 + 64 NuclAT_43 - -
MWM17_RS15250 (3155006) 3155006..3156106 - 1101 WP_001309461.1 sodium-potassium/proton antiporter ChaA -
MWM17_RS15255 (3156376) 3156376..3156606 + 231 WP_001146444.1 putative cation transport regulator ChaB -
MWM17_RS15260 (3156764) 3156764..3157459 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
MWM17_RS15265 (3157503) 3157503..3157856 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T40486 WP_000170965.1 NZ_AP025657:c3154065-3153958 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T40486 NZ_AP025657:c3154065-3153958 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT40486 NZ_AP025657:3154113-3154179 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References